Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E116P Olfactory Receptor

Gene Symbol OR7E116P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR9-5, HsOR9.2.2P, ORL325
External Ids HGNC: 15122   GeneBank: AF399421, BK004681, NG_004253   ORDB: ORL325   
Build #39 labels OR7E116P
Chromosomal location 9:90,232,098-90,233,123 (+)
Cluster 9@93
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E108P 93.57% 342
OR7E4P 89.12% 340
OR7E91P 88.89% 342

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 71% 329
Mouse Or7e178 68% 308
Rat Or7e173 64% 308
Cow OR7E186 66% 327
Orang OR7E111CP 86% 317
Orang OR7E100P 86% 315
Horse OR7E225 69% 322
Chimp OR7E111P 93% 297

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTTCTTCCCAAGGTGTCCAAGTCACACA
GAGCCACGGCATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCTGTCCTCGCTGGGCTGTCCCTGTCCATGTATCTGGTCACAGTGCTAAGG
AACCTGCTCATCATCCTGGCTGTGAGCTCTGACTCCCACCTCCACACCCCCATGTACTTC
TTCCTCTCCAACCTGTGCTGGGCTGACATCAGTTTCACCTCGGCCACGGTTCCCAAGATG
ACGGTGGACATGCAGTCGCATAGCAGAGTCATCTCTTATGCGGGCTGCCTGACACGGATG
TCTTTCTTCGTCCTTTTTGCATGTATAGAAGACATGCTCCTGACTGTGATGGCCTAGGAC
TGCTTTGTAGCCATCTGTCGCCCTCTGCACTACGCAGTCATCGTGAATCCTCACCTCTGT
GTCTTCTTAGTTTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCACAGTTAG
ATTGTGTTACAATTCACCTTCTTCAAGAATGTGGAAATCTCTCATTTTGTCTGTGAGCCA
TCTCAACTTCTCAACCTTGCCTGTTCTGACAGCTTCATCAATAGCATATTCATGTATTTC
GATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTACTATAAAATT
GTCCCCTCCATTCTAAGGATTTCATCGTCAGATGGGAAGTATAAAGCCTTCTCCACCTGT
GGCTCTCACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGCATTGGCGTGTACCTGACT
TCAGCTGTGGCACCACCCCCCAGCAATGGTGTGGTGGCATCAGTGAAGTACACCGTGGTC
ACCCCCATGCTGAACCCTTTCATCTACAGCCTGAGAAACAGGGACATTCAAAGCACCCTG
TGGAGGCTGTGCAGCAGAACAGTTAAATCTCTTGATCTGTTCCATTCTTTTTCTTGTGTG
GGTAAG
Conceptual translation LVFIFYFSNPLFFPRCPSHTEPRHLTGVXFLLLGLSEDPELQPVLAGLSLSMYLVTVLR
NLLIILAVSSDSHLHTPMYFFLSNLCWADISFTSATVPKMTVDMQSHSRVISYAGCLTRM
SFFVLFACIEDMLLTVMAXCFVAICRPLHYAVIVNPHLCVFLVLVSFFLSLLDSQLHSXbr/>IVLQFTFFKNVEISHFVCEPSQLLNLACSDSFINSIFMYFDSTMFGFLPISGILLSYYKI
VPSILRISSSDGKYKAFSTCGSHLAVVCLFYGTGIGVYLTSAVAPPPSNGVVASVKYTVV
TPMLNPFIYSLRNRDIQSTLWRLCSRTVKSLDLFHSFSCVGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 SNP T/C 1000GP (YRI)
9 90,232,966 90,232,966 SNP G/A 1000GP (CEU)
9 90,233,081 90,233,081 SNP T/C 1000GP (CEU, CHBJPT)
9 90,233,086 90,233,086 SNP C/A 1000GP (CEU, CHBJPT)
9 90,233,110 90,233,110 SNP C/T 1000GP (CEU, CHBJPT)
9 92,994,518 92,994,518 SNP A/G rs57510024 (DbSNP)
9 92,994,658 92,994,658 SNP C/T rs1888760 (DbSNP)
9 92,994,748 92,994,748 SNP C/G rs4083741 (DbSNP)
9 92,994,892 92,994,891 Ins(1) -/C rs35867447 (DbSNP)
9 92,994,986 92,994,986 SNP C/T rs2777623 (DbSNP)
9 92,995,078 92,995,077 Ins(1) -/C rs34120674 (DbSNP)
9 92,995,340 92,995,340 SNP T/G rs72492972 (DbSNP)
9 92,995,363 92,995,363 SNP C/T rs7861446 (DbSNP)
9 92,995,368 92,995,368 SNP A/C rs56125584 (DbSNP)
9 92,995,392 92,995,392 SNP C/T rs7852038 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.