Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E117P Olfactory Receptor

Gene Symbol OR7E117P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-1, HsOR11.2.2P, ORL3574
External Ids HGNC: 15303   GeneBank: AF399417, BK004788, NG_004384   ORDB: ORL3574   
Build #39 labels OR7E117P
Chromosomal location 11:3,599,644-3,600,669 (-)
Cluster 11@4a
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E129P 90.06% 342
OR7E7P 91.23% 342
OR7E87P 91.76% 340

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 65% 331
Chimp OR7E115P 85% 320
Chimp OR7E161P 87% 320
Chimp OR7E163BP 86% 320
Mouse Or7e178 62% 310
Rat Or7e173 59% 310
Cow OR7E186 64% 329
Orang OR7E103P 88% 307
Orang OR7E103BP 86% 301
Orang OR7E163P 87% 299
Horse OR7E225 65% 318

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTCCTTCTCAAGGTGTCCAAGACACACA
GAGCCATGGAATCTCACAGATGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCGGTCCTCGCTTTGCTCTCCCTGTCCCTGTCCATGTGTCTGGTCATGGTG
CTGAGGAACCTGCTCAGCATCCTGGCTGTCAGCTCTGTCTCTCCCCTCCACACCCCCGTG
TACTTCTTCCTCTCTAAACTGTGCTGGGCTGACATCGGTTTCACCTTGGCCACGGTTCCC
AAGATGGTTGTGGACATGCAGTCGCATAGCAGAGTCATCTCTCATGCGGGCTGTCTGACG
CAGATGTCTTTCTTCATCCTTTTTGCATGTATAGAAGGCATGCTCCTGACAGTGATGGCC
TATGACTGCTTTGTAGCCATCTGTCGCCCTCTGCACTACCCAGTCATCGTGAATCCTCAC
CTCTGTGTCTCCTTCCTTTTGGTGTCCTTTTTCCTTAGCATGTTGGATTCCCAGCTGCAC
AGTTGAATTGTGTTACAATTCACAATCATCAAGAATGTGGAAATCTCTAATTTTGTCTGT
GACCCCTCTCAACTTCTCAAACTTGCCTGTTCTGACAGCGTCATCAATAGCATATTCATA
TATTTCAATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTATGGTCTTACTGT
AAAATCGTCCCCTCCATTCTAAGGATTTCATCATCAGATGGGAAGTATAAAGCCTTCTCC
ACATGTGGCTCTCACCTAGCAGTTGTTTGCTGATTTTATAGAACAGGCATTGGCATGTAC
CTGACTTCAGCTGTGTCACCACCCCCCAGGAATGGTGTGGTGGCGTCAGCGATGTTCTCT
GTGGTCACCCCCATGCTGAACCTTTTCATCTACAGCCTGAGAAACAGGGACATACAAAGT
GCCCTGCGGAGGCTGCTCAGCAGAACAGTCGAATCTTATGATCTGTTCCATCCTTTTTCT
TGTGTG
Conceptual translation LVFIFYFSNPLSFSRCPRHTEPWNLTDVXFLLLGLSEDPELQPVLALLSLSLSMCLVMV
LRNLLSILAVSSVSPLHTPVYFFLSKLCWADIGFTLATVPKMVVDMQSHSRVISHAGCLT
QMSFFILFACIEGMLLTVMAYDCFVAICRPLHYPVIVNPHLCVSFLLVSFFLSMLDSQLH
SXVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINSIFIYFNSTMFGFLPISGILWSYC
KIVPSILRISSSDGKYKAFSTCGSHLAVVCXYRTGIGMYLTSAVSPPPRNGVVASAMFS
VVTPMLNLFIYSLRNRDIQSALRRLLSRTVESYDLFHPFSCV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI)
11 3,621,010 3,621,010 SNP A/G rs34735464 (DbSNP)
11 3,621,015 3,621,015 SNP C/T rs9735092 (DbSNP)
11 3,621,060 3,621,060 SNP T/G rs4910801 (DbSNP)
11 3,621,301 3,621,301 SNP C/T rs9735302 (DbSNP)
11 3,621,439 3,621,438 Ins(1) -/G rs35781336 (DbSNP)
11 3,621,541 3,621,541 SNP A/G rs9737075 (DbSNP)
11 3,621,583 3,621,583 Del(1) -/A rs34977624 (DbSNP)
11 3,621,593 3,621,593 SNP T/C rs1812223 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 235 (Hasin)
11 3,236,512 3,801,429 CopyNumber Variation_3833 (DGV)
11 3,405,664 3,622,881 CopyNumber Variation_85617 (DGV)
11 3,426,081 3,674,989 CopyNumber Variation_71243 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.