Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E121P Olfactory Receptor

Gene Symbol OR7E121P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR3.2.4P, ORL3109
External Ids HGNC: 15049   GeneBank: AF399409, NG_004395   ORDB: ORL3109   
Build #39 labels OR7E121P
Chromosomal location 3:75,598,651-75,599,673 (-)
Cluster 3@76
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E129P 87.68% 341
OR7E4P 88.56% 341
OR7E89P 87.39% 341

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 65% 330
Mouse Or7e178 61% 310
Rat Or7e173 59% 310
Cow OR7E186 62% 329
Orang OR7E103P 87% 307
Orang OR7E103BP 86% 301
Horse OR7E225 64% 318
Chimp OR7E163P 87% 320
Chimp OR7E115P 86% 320
Chimp OR7E161P 84% 320
Chimp OR7E4P 87% 299

Sequence information

Nucleotide sequence GTTTTTATCTTTTATTTTTCCAATCCTCTTTACTTCTCAAGGTGTCCAAGTCACACAGAG
CCACGGAATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCAGAA
CTGCAGCCGGTCCTCGCTTTGCTGTCCCTGTCCCTGTCCATGTATATGGTCACGGTGCTG
AGGAACCTGCTCAGCATCCTGGCTGTCAGCTCTGACTCCCCGCTCCACACCCCCATGTGC
TTCTTCCTCTCCAAACTGTGCTGAGCTGACATCGGTTTCACCTTGGCCATGGTTCCCAAG
ATGATTGTGAACATGCAGTCGCATAGCAGAGTCATCTCTTATGAGGGCTGCCTGACACGG
ATGTCTTTCTTTGTCCTTTTTGCATGTATGGAAGACATGCTCCTGACTGTGATGGCCTAT
GACTGCTTTGTAGCCATCTGTCGCCCTCTGCACTACCCAGTCATCGTGAATCCTCACCTC
TGTGTCTTCTTCGTCTTGGTGTCCTTTTTCCTTAGCCCGTTGGATTCCCAGCTGCACAGT
TGGATTGTGTTACTATTCACCATCATCAAGAATGTGGAAATCACTAATTTTGTCTGTGAA
CCCTCTCAACTTCTCAACCTTGCTTGTTCTGACAGCGTCATCAATAACATATTCATATAT
TTCGATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTACTATAAA
ATTGTCCCCTCCATTCTAAGGATGTCATCGTCAGATGGGAAGTATAAAGGCTTCTCCACC
TGTGGCTCTTACCTGGCAGTTGTTTGCTGATTTGATGGAACAGGCATTGGCATGTACCTG
ACTTCAGCTGTGTCACCACCCCCCAGGAATGGTGTGGTGGCGTCAGTGATGTATGCTGTG
GTCACCCCCATGCTGAACCTTTTCATCTACAGCCTAGGAAAGAGGGATATACAAAGTGTC
CTGCGGAGGCTGTGCAGCAGAACAGTCGAATCTCATGATATGTTCCATCCTTTTTCTTGT
GTG
Conceptual translation VFIFYFSNPLYFSRCPSHTEPRNLTGVXFLLLGLSEDPELQPVLALLSLSLSMYMVTVL
RNLLSILAVSSDSPLHTPMCFFLSKLCXDIGFTLAMVPKMIVNMQSHSRVISYEGCLTR
MSFFVLFACMEDMLLTVMAYDCFVAICRPLHYPVIVNPHLCVFFVLVSFFLSPLDSQLHS
WIVLLFTIIKNVEITNFVCEPSQLLNLACSDSVINNIFIYFDSTMFGFLPISGILLSYYK
IVPSILRMSSSDGKYKGFSTCGSYLAVVCXDGTGIGMYLTSAVSPPPRNGVVASVMYAV
VTPMLNLFIYSLGKRDIQSVLRRLCSRTVESHDMFHPFSCV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
3 75,598,672 75,598,672 SNP C/G 1000GP (CEU, CHBJPT)
3 75,598,736 75,598,736 SNP C/T 1000GP (CHBJPT)
3 75,599,287 75,599,287 SNP A/G 1000GP (CEU, CHBJPT)
3 75,599,316 75,599,316 SNP G/T 1000GP (CEU, CHBJPT)
3 75,599,416 75,599,416 SNP C/G 1000GP (CEU, CHBJPT)
3 75,647,823 75,647,823 SNP C/G rs3009018 (DbSNP)
3 75,647,887 75,647,887 SNP C/T rs7624950 (DbSNP)
3 75,647,944 75,647,944 SNP G/A rs2918539 (DbSNP)
3 75,647,967 75,647,966 Ins(1) -/G rs34385026 (DbSNP)
3 75,648,014 75,648,014 SNP A/G rs7636515 (DbSNP)
3 75,648,063 75,648,063 SNP T/C rs352392 (DbSNP)
3 75,648,225 75,648,225 SNP T/G rs2918538 (DbSNP)
3 75,648,438 75,648,438 SNP G/A rs2033819 (DbSNP)
3 75,648,567 75,648,567 SNP C/G rs3009017 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
3 75,250,088 75,853,296 CopyNumber Variation_5367 (DGV)
3 75,381,808 75,700,055 CopyNumber Variation_63499 (DGV)
3 75,392,078 76,003,036 CopyNumber Variation_2462 (DGV)
3 75,392,373 75,676,582 CopyNumber Variation_34587 (DGV)
3 75,392,373 75,776,083 CopyNumber Variation_8986 (DGV)
3 75,563,959 75,660,245 CopyNumber Variation_98352 (DGV)
3 75,567,240 75,817,199 CopyNumber Variation_68410 (DGV)
3 75,615,943 76,078,292 CopyNumber Variation_3434 (DGV)
3 75,624,620 75,659,285 CopyNumber Variation_91364 (DGV)
3 75,635,884 75,659,285 CopyNumber Variation_79799 (DGV)
3 75,637,410 75,650,668 CopyNumber Variation_91365 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.