Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E125P Olfactory Receptor

Gene Symbol OR7E125P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases PJCG6, ORL3215
External Ids HGNC: 15098   GeneBank: AF359416, AF399407, NG_004256, NG_004634, XM_496950   ORDB: ORL3215   
Build #39 labels OR7E125P
Chromosomal location 8:7,246,619-7,247,587 (-)
Cluster 8@7a
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E154P 100% 323
OR7E157P 96.59% 323
OR7E96P 96.59% 323

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E153 69% 306
Mouse Or7e178 64% 302
Rat Or7e173 61% 305
Cow OR7E186 68% 306
Orang OR7E103P 89% 307
Orang OR7E163P 88% 299
Orang OR7E163RP 88% 299
Orang OR7E103BP 87% 301
Horse OR7E225 69% 305
Chimp OR7E7P 89% 307
Chimp OR7E163TP 91% 299
Chimp OR7E161P 88% 309
Chimp OR7E115P 86% 309

Expression evidences

Source Accession
ESTs DB305141
mRNA AF359416

Sequence information

Nucleotide sequence ATGTTGGGACTAATATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGA
TCCAGAACTGCAGCCGGCCCTCGCTTTGCTGTCCCTGTCCCTGTCCATGTATCTGGTCAC
GGTGCTGAGGAACCTGTTCAGCATCCTGGCTGTCAGCTCTGACTGCCCCCTCCACACCCC
CATGTACTTCTTCCTCTCCAACCTGTGCTGGCCTGACATCGGTTTCACCTCGGCCATGGT
TCCCAAGATGATTGTGGACACGCAGTCGCATAGCAGAGTCATCTCTCATGCGGGCTGCCT
GACACAGATGTCTTTCCTGCTCCTTGTTGCATGTATAGAAGGCATGCTCCTGACTGTGAT
GGCCTATGACTGCTTTGTAGCCATCTGTCGCCCTCTGCACTACCCAGTCATCGTGAATCC
TCACCTCTGTGTCTTCTTCGTTTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCT
GCACAGTTGGATTGTGTTACAATTAACCATCATCAAGAATGTGGAAATCTCTAATTTGGT
CTGTGACCCCTCTCAACTTCTCAAACTTGCCTGTTCTGACAGTGTCATCAATAACATATT
CATATATTTCGATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCTTTTTGTCTTA
CTATAAAATTGTCCCCTCCATTCTAAGGATTTCATCGTCAGATGGGAAGTATAAAGCCTT
CTCCACCTGTGGCTGTCATCTAGCAGTTGTTTGCTGGTTTTATGGAACAGGCATTGGCAT
GTACCTGACTTCAGCTGTGTCACCACCCCCCAGGAATGGTGTGGTGGCATCAGTGATGTA
CGCTGTGGTCACCCCATGCTGAACCTTTTCATCTGCAGCCTGAGAAACAGGGACATACAA
AGTGCCCTGCGGAGGCTGGGCAGCAGAGCATTCGAATCTCATGATCTGTTCCATCCTTTT
TCTTGTGTG
Conceptual translation MLGL\LTGVXFLLLGLSEDPELQPALALLSLSLSMYLVTVLRNLFSILAVSSDCPLHT
PMYFFLSNLCWPDIGFTSAMVPKMIVDTQSHSRVISHAGCLTQMSFLLLVACIEGMLLTV
MAYDCFVAICRPLHYPVIVNPHLCVFFVLVSFFLSLLDSQLHSWIVLQLTIIKNVEISNL
VCDPSQLLKLACSDSVINNIFIYFDSTMFGFLPISGIFLSYYKIVPSILRISSSDGKYKA
FSTCGCHLAVVCWFYGTGIGMYLTSAVSPPPRNGVVASVMYAVV/PMLNLFICSLRNRD
IQSALRRLGSRAFESHDLFHPFSCV

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
8 6,731,720 8,306,743 CopyNumber Variation_3719 (DGV)
8 6,884,206 8,174,628 CopyNumber Variation_0296 (DGV)
8 6,921,404 8,145,931 CopyNumber Variation_2732 (DGV)
8 6,925,972 8,065,971 InversionBreakpoint Variation_0348 (DGV)
8 6,949,150 7,106,348 CopyNumber Variation_2114 (DGV)
8 7,007,415 7,368,995 CopyNumber Variation_52607 (DGV)
8 7,053,215 7,753,552 CopyNumber Variation_7702 (DGV)
8 7,054,054 7,251,166 CopyNumber Variation_4578 (DGV)
8 7,060,331 7,212,430 CopyNumber Variation_70255 (DGV)
8 7,066,055 7,474,581 CopyNumber Variation_70256 (DGV)
8 7,102,793 7,161,031 CopyNumber Variation_36861 (DGV)
8 7,104,792 7,892,745 CopyNumber Variation_31424 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
PJCG6andOR7E125P.aApr07 main_exon 3UTR chr8 7,246,581 7,246,619 -
CDS_partial chr8 7,246,619 7,247,531 -