Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E155P Olfactory Receptor

Gene Symbol OR7E155P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR13.1.2P
External Ids HGNC: 31310   GeneBank: NG_004435   
Build #39 labels
Chromosomal location 13:41,439,837-41,440,862 (-)
Cluster 13@42
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E108P 85.96% 342
OR7E129P 84.8% 342
OR7E1P 85.67% 342

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 66% 331
Mouse Or7e178 64% 310
Rat Or7e173 60% 309
Cow OR7E186 62% 329
Orang OR7E111CP 81% 319
Orang OR7E100P 81% 317
Orang OR7E111P 84% 299
Horse OR7E225 66% 315
Chimp OR7E102P 83% 323
Chimp OR7E115P 83% 320
Chimp OR7E163P 83% 320

Expression evidences

Source Accession
ESTs BG995764

Sequence information

Nucleotide sequence CTGCTTTTTGTCTTTTATTTTTCCAATCTTCTTTCCTTCTCAAGGTGTCCAAGTCACACA
GAGCCACGGAGTCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGGGGATCCA
GAACTGCAGCCGGTCCTTGCTTTGCTGTCCCTGTCCCTGTCCATGTATCTGGTCACGGTG
CTGAGGAACCTGCTCATCATCCTGGCTGTCAACCCTGACTCCCACCTCCACACCCCCATG
TACTTCTTCCTCTCCAACCTGTGCTGGGCTAACCTCAGTTTCACCTCGGCCACGGTTCCC
AAGATGACTGTGGACATGCAGTTGCATAGCAGAGTCATCTCTCATGCGGGCTGCCTGACA
CAGATGTCTTTCTTGGTCCTTTTTGCATGTATAGAAGACATGCTCCTGACCATGATGGCC
TATGACTGCTTTGTAGCCATCTGTCGCCCTCTGCACTACCCAGTCATTGTGAATCCTCAC
CCTCTGTGTCTTCTTCATTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCAC
AGTTGGATTGTGTTACAATTCACCATCTTCAAGAATGTGGAAATCTCTACTTTTGTCTGT
GAGCCATCTCAACTTCTCAACCTTGCCTGTTCTGACAGTGTCATCAATAGAATATTCATG
TATTTCGATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGTTCCTTTTGTCTTTCTAT
AAAATTGTCCCCTCCATTCTAAGGATGTCATCATCAGATGGGAAGTATAAAGCCCTTGCC
ACCTGTGGCTCTCACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGCATTGGCGTGCAC
CTGACTTCAGCTGTGGCACCACCCCCCAGGAATGGTGTGGTGGCGTCAGTGATGTACGCT
GTGGTCACCCCCATGCTGAACCCTTTCATCTACAGCCTGAGAAACAGGGACATTCAAAGT
GCCCTGCAGAGGCTGCGCAGCACAACAGTCGAATCTCATGATCTGTTCCATCCTTTTTCT
TGTGTG
Conceptual translation LLFVFYFSNLLSFSRCPSHTEPRSLTGVXFLLLGLSGDPELQPVLALLSLSLSMYLVTV
LRNLLIILAVNPDSHLHTPMYFFLSNLCWANLSFTSATVPKMTVDMQLHSRVISHAGCLT
QMSFLVLFACIEDMLLTMMAYDCFVAICRPLHYPVIVNPHPLCLLHLVSFFLSLLDSQLH
SWIVLQFTIFKNVEISTFVCEPSQLLNLACSDSVINRIFMYFDSTMFGFLPISGFLLSFY
KIVPSILRMSSSDGKYKALATCGSHLAVVCLFYGTGIGVHLTSAVAPPPRNGVVASVMYA
VVTPMLNPFIYSLRNRDIQSALQRLRSTTVESHDLFHPFSCV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
13 42,014,114 42,014,114 SNP C/T rs11147841 (DbSNP)
13 42,014,227 42,014,227 SNP C/G rs74054054 (DbSNP)
13 42,014,246 42,014,246 SNP C/T rs7994185 (DbSNP)
13 42,014,552 42,014,552 SNP A/G rs9566769 (DbSNP)
13 42,014,699 42,014,698 Ins(1) -/G rs34245885 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 110 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.