Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E160P Olfactory Receptor

Gene Symbol OR7E160P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR8.4.3P
External Ids HGNC: 31233   GeneBank: NG_004399   
Build #39 labels
Chromosomal location 8:12,033,617-12,034,642 (-)
Cluster 8@12b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E129P 90.35% 342
OR7E145P 88.89% 342
OR7E8P 89.18% 342

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 65% 331
Chimp OR7E161P 89% 320
Chimp OR7E163BP 87% 320
Chimp OR7E163MP 88% 320
Mouse Or7e178 62% 308
Rat Or7e173 57% 310
Cow OR7E186 63% 331
Orang OR7E103P 89% 307
Orang OR7E103BP 87% 301
Orang OR7E163P 88% 299
Horse OR7E225 65% 318

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTCCTTCTCAAGGTGTCCAAGACACACA
GGGCCACGGAATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCGGTCCTCGCTTTGCTGTCCCTGTCCCTGTCCATGTATCTGGTCACGGTG
CTGAGGAACCTGCTCAGCATACCGGCTGTCAGCTCTGACTCCCCCCTCCACACCCCCACG
TAATTCTTCCTCTCCAACCTGTGCTGGGCTGACATGGGTTTCACCTCAGCCACGGTTCCC
AAGATGATTGTGGACATGCAGTCACATAGCAGAGTCATCTCTCATGCGGGCTGCCTGACA
CAGATGTATTTCTTGGTCCTTTTTGCATGTATAGAAGGCATGCTCCTGACTGTGATGGCC
TATGACTGCTTTGTAGACATCTGTGGCCCTCTGCACTATCCAGTCATCGTGAATCCTCAC
CTCTGTATCTTCTTCGTCTTGGTGTCCTTTTTCCTCAGCCTGTTGGATTCCCAGCTGCAC
AGTTGGATTGTGTTATAACTCACCATCATCAAGAATGTGGAAATCTCTCATTTTGTCTGT
GACCCCTCTCAACCTCTCAAACTTGCCTGTTCTGACAGCGTCATCAATAGCATATTCATA
TATTTCGATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTTTTGTCTTACTAT
AAAACTGTCCCCTCCATTCTAAGGATTTCATCGTCAGATGGGAAGTATAAAGCTTTCTCC
ACCTGTGGCTCTCACCTAGCAGCTGTTTGCTGATTTTATGGAGCAGACATTGTCGTGTAC
CTGGCTTCAGCTGTGTCACCACCCCCCAGGAGTGGTGTGGTGGCATCAGTGATGTACGCT
GTGGTCACCCCCATGCTGAACCTTTTCATGTACAGCCTGAGAAACAGGGACATACAAAGT
GCCCTGCGGAGGCTGCGCAGCAGAACAGTGGAATCTCATGATCTGTTCCATCCTTTTTCT
TGTGTG
Conceptual translation LVFIFYFSNPLSFSRCPRHTGPRNLTGVXFLLLGLSEDPELQPVLALLSLSLSMYLVTV
LRNLLSIPAVSSDSPLHTPTXFLSNLCWADMGFTSATVPKMIVDMQSHSRVISHAGCLT
QMYFLVLFACIEGMLLTVMAYDCFVDICGPLHYPVIVNPHLCIFFVLVSFFLSLLDSQLH
SWIVLXTIIKNVEISHFVCDPSQPLKLACSDSVINSIFIYFDSTMFGFLPISGILLSYY
KTVPSILRISSSDGKYKAFSTCGSHLAAVCXYGADIVVYLASAVSPPPRSGVVASVMYA
VVTPMLNLFMYSLRNRDIQSALRRLRSRTVESHDLFHPFSCV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
8 11,891,658 11,891,658 SNP A/C rs9644692 (DbSNP)
8 11,891,593 11,891,593 SNP A/G rs4841679 (DbSNP)
8 11,891,905 11,891,905 SNP A/G rs4841680 (DbSNP)
8 11,891,984 11,891,984 SNP A/G rs4841681 (DbSNP)
8 11,891,617 11,891,617 SNP A/G rs11781510 (DbSNP)
8 11,892,052 11,892,052 SNP A/G rs9329260 (DbSNP)
8 11,892,059 11,892,059 SNP A/G rs9329261 (DbSNP)
8 11,891,805 11,891,805 SNP A/G rs56051617 (DbSNP)
8 11,892,020 11,892,020 SNP C/T rs9329259 (DbSNP)
8 11,892,090 11,892,090 SNP C/T rs62493663 (DbSNP)
8 11,891,329 11,891,329 SNP C/T rs4841678 (DbSNP)
8 11,891,669 11,891,669 SNP G/T rs36042437 (DbSNP)
8 12,033,795 12,033,795 SNP G/C 1000GP (CEU)
8 12,033,820 12,033,820 SNP C/T 1000GP (CEU)
8 12,034,149 12,034,149 SNP A/C 1000GP (CEU)
8 12,034,396 12,034,396 SNP A/G 1000GP (CEU, CHBJPT)
8 100 -100 SNP G/C 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
8 11,870,657 12,287,699 InversionBreakpoint Variation_0349 (DGV)
8 11,845,324 12,601,971 CopyNumber Variation_2736 (DGV)
8 11,741,558 12,567,301 CopyNumber Variation_3720 (DGV)
8 11,891,593 11,898,209 CopyNumber Variation_10237 (DGV), Variation_52354 (DGV), Variation_52355 (DGV)
8 7,219,660 12,005,446 Inversion Variation_37303 (DGV)
8 7,426,605 12,450,985 Inversion Variation_37304 (DGV)
8 7,437,436 12,456,008 Inversion Variation_37305 (DGV)
8 7,451,668 12,441,708 Inversion Variation_37306 (DGV)
8 7,460,958 12,435,737 Inversion Variation_37307 (DGV)
8 7,897,445 12,444,758 Inversion Variation_37311 (DGV)
8 7,901,538 12,444,659 Inversion Variation_37312 (DGV)
8 7,903,571 12,438,688 Inversion Variation_37313 (DGV)
8 7,906,494 12,437,216 Inversion Variation_37314 (DGV)
8 7,993,421 12,424,508 Inversion Variation_37315 (DGV)
8 7,993,425 12,429,396 Inversion Variation_37316 (DGV)
8 8,024,528 12,061,148 Inversion Variation_37317 (DGV)
8 8,024,710 12,055,996 Inversion Variation_37318 (DGV)
8 8,098,045 12,324,868 Inversion Variation_37319 (DGV)
8 8,100,604 12,316,276 Inversion Variation_37320 (DGV)
8 8,113,868 12,306,378 Inversion Variation_37321 (DGV)
8 11,698,747 12,551,156 CopyNumber Variation_52352 (DGV)
8 11,788,350 11,893,225 InDel Variation_43720 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.