Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E16P Olfactory Receptor

Gene Symbol OR7E16P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases CIT-B-440L2, OR19-11, OR19-133, OR19-9, HsOR19.2.9P, ORL3782
External Ids HGNC: 8387   GeneBank: AF399399, BK004546, NG_002189, U86252   ORDB: ORL3782   
Build #39 labels OR7E16P
Chromosomal location 19:9,191,236-9,192,155 (+)
Cluster 19@9b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E109P 84.12% 296
OR7E14P 85.37% 294
OR7E31P 82.71% 295

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E153 74% 305
Mouse Or7e178 70% 307
Rat Or7e177 69% 290
Cow OR7E186 71% 304
Orang OR7E14P 84% 294
Orang OR7E13P 83% 298
Orang OR7E109P 82% 296
Horse OR7E225 71% 304
Chimp OR7E14P 85% 294
Chimp OR7E36P 83% 299

Sequence information

Nucleotide sequence GAAGAGATATTATGAATAATATCCCAGCATGTACACACAGGGTGTGTACAGATTAAGAAC
TGCAGCCCATCCTCTTTGGGCTGTTCCTGTCCATGTGCCTGGTCATGGTGCTGGGGAACC
TTCTCATCATCCTGGCCGTCAGCTCTGACTCCCACCTCCACACCCCCACGTACTTTTTCC
TCTCCAACCTGTCCTTGGCTGACATCGGTTTCCCCTCCACCACTGTCCCCAAGATGATTG
TGGACATCCAGTCTCACAGCAGAGTCATCTCCTATGCGGGCTGCCTGACTCAGATATCTC
TTTTTGCTGTTTTTGGATGCATGGAAGACATGCTTCTGAGTGTGATGGCTTATGACCGGT
TTGTGGCCATCTGTCACCCTCTGGATTATCCAGTCATCATGAACCCATGTTTCTGTGGCT
TCCTGGTTTTGTTGTCTTTTTTTTCTCAGTCTTTTAGACTTCCAGCTGCACAATTGGATT
GCCTTACAAATTACCTGCTTCAAGGATGTGGAAATTCCCAGTTTCTTCTGTGACCCTTCT
CAACTCCCCCACCTTGCCTGTTGTGACACCTTCACCAACAACATAGTCATGTATTTCCTT
GCTGCCATACTTGGTTTTCTTCCCATCTCGGGGATCTTTTCTCTTACTATAAAATTGTTT
CCTCCATTCTGAAGGTTTCATCATCAGGTGGGAAGTATAAAGCCTTCTCCACCTGTGGCT
CTCACCTGTCAGTTGTTTGCTTATTTTATGGAACAGCCCTTGGAGGGTACCTCAGTTCAG
ACATGTCCTCTTATCCCAGAAAGGGTGCAGTGGCTTCAGTGATGTACACAGTGGTCGCCC
CCATGCTGAACCCGTTCATCTACAGCCTGAGAAAAAGGGACATTAAAAGTGCCCTGCAGC
AGCTGCATGGCAGAATAGTC
Conceptual translation EEILXISQHVHTG/CTDXLQPILFGLFLSMCLVMVLGNLLIILAVSSDSHLHTPTYF
FLSNLSLADIGFPSTTVPKMIVDIQSHSRVISYAGCLTQISLFAVFGCMEDMLLSVMAYD
RFVAICHPLDYPVIMNPCFCGFLVLL\FFLSLLDFQLHNWIALQITCFKDVEIPSFFCD
PSQLPHLACCDTFTNNIVMYFLAAILGFLPISG/LFSYYKIVSSILKVSSSGGKYKAFS
TCGSHLSVVCLFYGTALGGYLSSDMSSYPRKGAVASVMYTVVAPMLNPFIYSLRKRDIKS
ALQQLHGRIV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,302,144 9,302,144 SNP A/G rs2005851 (DbSNP)
19 9,301,955 9,301,955 SNP C/G rs68119574 (DbSNP)
19 9,301,994 9,301,994 SNP G/T rs2005850 (DbSNP)
19 9,191,279 9,191,279 SNP G/C 1000GP (CEU, CHBJPT)
19 9,191,318 9,191,318 SNP G/T 1000GP (CEU, CHBJPT)
19 9,191,467 9,191,467 SNP A/G 1000GP (CHBJPT)
19 100 -100 SNP G/C 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,267,749 9,313,321 CopyNumber Variation_35700 (DGV)
19 9,271,324 9,311,170 CopyNumber Variation_35701 (DGV)
19 9,295,591 9,317,125 CopyNumber Variation_50243 (DGV)
CopyNumber 26 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.