Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E18P Olfactory Receptor

Gene Symbol OR7E18P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR19-14, TPCR26, HsOR19.2.15P, ORL210
External Ids HGNC: 8389   GeneBank: HSTPCR26P, NG_004360   ORDB: ORL210   
Build #39 labels OR7E98P, OR7E18P
Chromosomal location 19:9,260,977-9,261,797 (-)
Cluster 19@9b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E16P 91.94% 248

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E153 74% 246
Mouse Or7e178 69% 248
Rat Or7e177 67% 248
Cow OR7E186 74% 239
Orang OR7E16P 87% 248
Horse OR7E225 72% 254
Chimp OR7E14P 81% 264
Chimp OR7E36BP 83% 254
Chimp OR7E36P 83% 253

Expression evidences

Source Accession
mRNA X89673

Sequence information

Nucleotide sequence ATCCAATGCAAGGGCTAATAGAAGTGAATTAAGACATTCTCTGTAACTCCAATATTAAAT
GGAAACCGGGAAATAGCCAGATTCCTCTCCAACCTGTCCTTGGCTGGCATCGGTTTCCCC
TCCACCATAGTCTCCAAGATGATTGTGGACATCCAGTCTCACAGCAGAGTCATCTCCTAT
GCGGGCTGCCTGACTCAGGTATCTCTTTTTGCCGTTTTTGGATGCATGGAAGACATGCTT
CTGAGTGTGATGGCTTATGACCGGTTTGTGGACATCTGTCACCCTCTGGATTATCCAGTC
ATCATGAACCCATGTTTCTGTGGCTTCCTAGTTTTGTTGTCTTTTTTTCTCAGTCTTTTA
GACTCCCAGCTGCACAATTGGATTGCCTTACAAATTACCTGCTTCAAGGATGTGGAAATT
CCCAATTTCTTCTGTGACCCTTCTCAACTCCCCCACCCTTGCCTGTTGTGACACCTTCAC
CAATGACATAGTCATGTATTTCCTTGCTGCCATATTTGGTTTTCTTCCCATTTCGGGGAC
CTTTTCTCTTACTATAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGAAG
TATAAAGCCTTCTCCACCTGTGGCTCTCACCTGTCAGTTGTTTGCTTATTTTATGGAACA
GGCTTTGGAGGGGACCTCAGTTCAGACATGTCCTCTTATCCCAGAAAAGGTGCAGTGGCC
TCAGTGATGTACACGGTGGTTACTCCCATGCTGAACCCCTTCATCTACAGCCTAACAGGG
AAATTAAAAGTGCCCTGCGGCAGCTGCACTGCAGAATAGTC
Conceptual translation IQCKGXKXKTFSVTPILNGNREIARFLSNLSLAGIGFPSTIVSKMIVDIQSHSRVISY
AGCLTQVSLFAVFGCMEDMLLSVMAYDRFVDICHPLDYPVIMNPCFCGFLVLLSFFLSLL
DSQLHNWIALQITCFKDVEIPNFFCDPSQLPH\ACCDTFTNDIVMYFLAAIFGFLPISG
/LFSYYKIVSSILRVSSSGGKYKAFSTCGSHLSVVCLFYGTGFGGDLSSDMSSYPRKGA
VASVMYTVVTPMLNPFIYSL/REIKSALRQLHCRIV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,372,161 9,372,161 SNP A/G rs8104515 (DbSNP)
19 9,372,292 9,372,292 SNP A/G rs62103650 (DbSNP)
19 9,261,143 9,261,143 SNP C/T 1000GP (CHBJPT)
19 100 -100 SNP A/G 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,369,653 9,372,573 Deletion #294 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E18P.aApr07-unspliced main_exon CDS_partial chr19 9,261,054 9,261,525 -