Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E19P Olfactory Receptor

Gene Symbol OR7E19P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR19-7, HSCIT-B-440L2, TPCR110, HsOR19.2.16P, ORL205, ORL3779
External Ids HGNC: 8390   GeneBank: AF399426, HSTPCR110, NG_002356   ORDB: ORL205, ORL3779   
Build #39 labels OR7E19P
Chromosomal location 19:9,265,393-9,266,369 (-)
Cluster 19@9b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E108P 77.06% 327
OR7E116P 78.29% 327
OR7E22P 77.68% 327

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 73% 328
Chimp CONTIG*********** 99% 326
Mouse Or7e178 70% 308
Rat Or7e173c 68% 293
Cow OR7E186 69% 328

Expression evidences

Source Accession
ESTs DB337981
mRNA X89668
GNF Atlas2 216536_at

Sequence information

Nucleotide sequence ATTTATGTCTTTTATTTTTTCAACCCTCTTTTCTTCTCAAGGTGTCCAAGTTACACAGAC
TCGCAGAATCTCACAGGTGTCTTAGAATTTCTCTTCCTGGGACTCTCAGAGGATCCAGAA
CTGCAGCCCGTCCTCGTTGGGCTGTTCCTGTCCATGTACCTGATCACGGTGCTGGGGAAC
CTGCTCATCATCCTGGCCGTCAGCTGTGACTCCCACCTCCACACCCCCATGTACTTCTTC
CTCTCCAACTTGTCCTTGGCTGACATCGGACTCACCTCTGCCACCATCCCTAAGATGATT
GTTGATATGCAATCTCACAGCAGAATCATCTCCTATGAGGGCTGCCTGATGCAGATGTCT
TTATCTATTTTGTGTGTATGAATGACATGGTCCTGACTGTGATGGCCTATGACCAGTTTG
TGGCCATTTGTCACCCCCTACGCTACCCAGTCATCATGAATCCCCATCTCTGTGTCTTCT
TAGTTTTGGTGTCTTTTATTCTTAGCCTGTTGAACTCCCAGCTGCACAATCAGATTGTGT
TACAATTCACCTGCTTCAAGAATGTGGAAATCTTTAATTTTTTCTGTGAGCCATCTCAAC
TTCTCAACCTTGCCTGTTCTGACAGTGTCATCAATAACATATTCATGTATTTAGATAGTG
TTATATTTGGTTTTCTTCCCATCTCAGGGATCCTTTTGTCTTACTATAAAATTGTCTCCT
CCATTCTAAGAATTCCATCATCAGATGGGAAGTATAAAGCCTTCTCCACATGTGGCTCTC
ACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGACTTGGAGCCTACCTCAGTTCAGCTG
CGTCCTCTTTCCCCAGGAAGGGTGCGGTCACCTCAGTGATGTACACTGTGGTCATCCCTA
TGCTGAACCCCTTCATCTACAGCCTGAGAAACAGGGACATTAAAAGTGCCCTGTGGAGGC
TGCACAGCAGAACAGTC
Conceptual translation IYVFYFFNPLFFSRCPSYTDSQNLTGVLEFLFLGLSEDPELQPVLVGLFLSMYLITVLGN
LLIILAVSCDSHLHTPMYFFLSNLSLADIGLTSATIPKMIVDMQSHSRIISYEGCLMQM/br/>SFIYFVCMNDMVLTVMAYDQFVAICHPLRYPVIMNPHLCVFLVLVSFILSLLNSQLHNQI
VLQFTCFKNVEIFNFFCEPSQLLNLACSDSVINNIFMYLDSVIFGFLPISGILLSYYKIV
SSILRIPSSDGKYKAFSTCGSHLAVVCLFYGTGLGAYLSSAASSFPRKGAVTSVMYTVVI
PMLNPFIYSLRNRDIKSALWRLHSRTV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,376,999 9,376,999 SNP G/T rs12151250 (DbSNP)
19 100 -100 SNP C/T 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
7tm_1.3.aApr07 main_exon CDS_partial chr19 9,265,896 9,266,328 -
exon_5UTR chr19 9,269,796 9,270,331 -
OR7E19P.aApr07-unspliced main_exon CDS_partial chr19 9,265,474 9,265,945 -