Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E21P Olfactory Receptor

Gene Symbol OR7E21P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR4DG, OST035, OR3-12, HsOR3.6.2P, ORL4096
External Ids HGNC: 8393   GeneBank: BK004795, NG_004123   ORDB: ORL4096   
Build #39 labels OR7E21P, OR7E127P
Chromosomal location 3:130,034,489-130,035,542 (-)
Cluster 3@130
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E53P 89.18% 342
OR7E59P 87.54% 321
OR7E84P 87.54% 321

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 65% 336
Mouse Or7e178 64% 316
Rat Or7e173 61% 311
Cow OR7E186 62% 338
Orang OR7E84BP 82% 328
Orang OR7E12P 84% 317
Orang OR7E14P 81% 328
Orang OR7E53P 83% 317
Horse OR7E225 64% 321
Chimp OR7E53P 83% 335
Chimp OR7E36P 83% 328
Chimp OR7E53CP 86% 313
Chimp OR7E59P 84% 318

Expression evidences

Source Accession
ESTs AA815433

Sequence information

Nucleotide sequence TTGTTTCCGATTTTGCAACCCTCTTTTCCAGGCAAAAGAGGGTCGTATCCAAACGATACA
GACCCACAGAGTCTAACAGATGTCTCTATATTCCTCCTCCTCGAACTCTCAGAGGATCCA
GAACTGCAGCCGGTCGTCGCTGGGCTGTTCCTGTCCATGTGCCTGGTCACGGTGCTGGGG
AACCTGCTCATCATCCTGGCCGTCAGCCCTGACTCCCACCTCCCCACCCCCATGTACTTC
TTCCTCTCCAACCTGTCCTTGCCTGACATCGGTTTCACCTCCACCACGGTCCCCAAGATG
AGCGTGGACATCCAGTCTCACAGCAGAGTCATCTCCTATGCAGGCTGCCTGACTCAGATG
TCTCTCTTTGCCATTTTTGGAGGCATGGAAGAGAGACATGCTCCTGAGGTGATGGCCTAT
GACCTGTTTGTAGCCATCTGTCACCTTCTATATCGTTCAGCCATCTTGAACCCGTTTGTC
CGTGGCTTCCTAGATTTGTTGTCTTTGTTGTTGGTTTTTTTTTTTTTTCTCTCAGTCTTT
TAGACTCCCAGCTGCACAACTTGATTGCCTTACAAATGACCTACTTCAAGGATGTGGAAA
TTCCTAATTTCTTCTGGGAACCTTCTCAACTCCCCCATCTTGCATGTTGTGACACCTTCA
CCAGGAACAACAACATGTATTTCCCTGCTGCCGTATTTGGTTTTCTTCCCATCTCGGGGA
CCCTTTTCTCTTACTGTAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGA
AGTACAAACCTTCTCCACCTGTGGGTCTCACCTGTCAGTTGTTTGCTGATTTTATGGAGC
AGGCGTTGGAGGGTACCTTGGTTCAGATGTGTCATCTTCCCCGAGAAAGGGTGCAGTGGC
CTCAGTGACGTACGTACACGGTGGTCACCCCCATGCTGAACTCCTTCATCTACAGCCTGA
GAAACGGGGATATTAAAAGTGTCCTACGGCGGCCGCATGGCAGCACAGTCTAATCTCAAT
ACGTTCTTATCTGTTCCATTCCTTTTGTAGGGTG
Conceptual translation LFPILQPSFPGKRGSYPNDTDPQSLTDVSIFLLLELSEDPELQPVVAGLFLSMCLVTVLG
NLLIILAVSPDSHLPTPMYFFLSNLSLPDIGFTSTTVPKMSVDIQSHSRVISYAGCLTQM
SLFAIFGGMEERHAPEVMAYDLFVAICHLLYRSAILNPFVRGFL\CCLCCWFFFFF\S
LLDSQLHNLIALQMTYFKDVEIPNFFWEPSQLPHLACCDTFTRNNNMYFPAAVFGFLPIS
GTLFSYCKIVSSILRVSSSGGKYK/FSTCGSHLSVVCXYGAGVGGYLGSDVSSSPRKG
AVASVTYVH\VTPMLNSFIYSLRNGDIKSVLRRPHGSTVXQYVL/LFHSFCRV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP G/A 1000GP (YRI, YRI)
3 129,753,400 129,753,400 SNP C/T rs4484231 (DbSNP)
3 129,753,772 129,753,772 SNP A/G rs4330292 (DbSNP)
3 129,753,775 129,753,775 SNP A/G rs4330293 (DbSNP)
3 129,754,030 129,754,030 SNP A/T rs57241049 (DbSNP)
3 129,754,031 129,754,031 SNP C/G rs59587362 (DbSNP)
3 129,754,082 129,754,082 SNP C/T rs35334056 (DbSNP)
3 129,754,134 129,754,134 SNP A/G rs60911235 (DbSNP)
3 129,754,265 129,754,265 SNP C/T rs35668549 (DbSNP)
3 130,034,557 130,034,557 SNP T/C 1000GP (CEU)
3 130,035,014 130,035,014 SNP G/A 1000GP (CEU)
3 130,035,518 130,035,518 SNP A/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
3 129,659,467 129,939,982 CopyNumber Variation_3448 (DGV)
3 129,709,647 129,939,373 CopyNumber Variation_2472 (DGV)
3 129,717,806 129,811,929 CopyNumber Variation_91539 (DGV)
3 129,721,138 129,754,286 CopyNumber Variation_91540 (DGV)
3 129,741,603 129,811,401 CopyNumber Variation_36060 (DGV)
3 129,749,665 129,829,487 CopyNumber Variation_36061 (DGV)
3 129,752,787 129,813,466 CopyNumber Variation_36062 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.