Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E24 Olfactory Receptor

Gene Symbol OR7E241 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene No
CORP pseudogene probability score
Aliases CIT-B-440L2, OR19-8, OR19-14, HsOR19.2.14
External Ids HGNC: 8396   GeneBank: AF399400, BK004227, HSHT2, NR_002146   
Build #39 labels OR7E24P
Chromosomal location 19:9,251,044-9,252,060 (+)
Cluster 19@9b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E100P 75.96% 337
OR7E19P 75.69% 325
OR7E25P 79.82% 327

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 80% 318
Chimp CONTIG875.22-740 80% 313
Chimp CONTIG*********** 76% 337
Chimp CONTIG*********** 75% 325
Mouse Or7e178 75% 308
Rat Or7e177 71% 293
Cow OR7E186 73% 330

Expression evidences

Source Accession
ESTs BX279722
mRNA Y10529
GNF Atlas2 215463_at

Sequence information

Nucleotide sequence ATGTCCTATTTTCCAATTCTCTTTTTTTTTTTCCTCAAAAGGTGTCCGAGCTACACAGAG
CCACAGAATCTCACAGGTGTCTCAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCAGAA
CTGCAGCCGGTCCTCGCTGGGCTGTTCCTGTCCATGTACCTGGTCACGGTGCTGGGGAAC
CTGCTCATCATCCTGGCTGTCAGCTCTGACTCCCACCTCCACACCCCCATGTACTTCTTC
CTCTCCAACCTGTCCTTGGCTGACATCGGTTTCACCTCCACCACGGTCCCCAAGATGATT
GTGGACATGCAAACTCACAGCAGAGTCATCTCCTATGAAGGCTGCCTGACTCAGATGTCT
TTTTTTGTCCTTTTTGCATGTATGGATGACATGCTCCTGAGTGTGATGGCCTATGACCGG
TTTGTGGCCATCTGTCACCCCCTGCACTACCGAATCATCATGAACCCACGCCTCTGTGGC
TTCTTAATCTTGTTGTCTTTTTTTATTAGTCTTTTGGACTCCCAGTTGCACAATTTGATT
ATGTTACAGCTCACCTGCTTCAAGGATGTGGACATTTCTAATTTCTTCTGTGACCCTTCT
CAACTCCTCCACCTTAGGTGTTCCGACACCTTCATCAATGAAATGGTCATATATTTCATG
GGTGCCATATTTGGCTGTCTCCCTATCTCAGGGATCCTTTTCTCTTACTATAAAATTGTT
TCCCCCATTCTGAGAGTTCCAACATCAGATGGGAAGTATAAAGCCTTCTCCACCTGTGGC
TCTCACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGGCTTGTAGGGTACCTCAGTTCA
GCTGTGTTACCATCCCCCAGGAAGAGTATGGTGGCTTCAGTGATGTACACTGTGGTCACC
CCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAAGGACATTCAAAGTGCCCTGTGC
AGGCTGCATGGCAGAATCATCAAATCTCATCATCTCCATCCTTTTTGTTATATGGGA
Conceptual translation MSYFPILFFFFLKRCPSYTEPQNLTGVSEFLLLGLSEDPELQPVLAGLFLSMYLVTVLGN
LLIILAVSSDSHLHTPMYFFLSNLSLADIGFTSTTVPKMIVDMQTHSRVISYEGCLTQMS
FFVLFACMDDMLLSVMAYDRFVAICHPLHYRIIMNPRLCGFLILLSFFISLLDSQLHNLI
MLQLTCFKDVDISNFFCDPSQLLHLRCSDTFINEMVIYFMGAIFGCLPISGILFSYYKIV
SPILRVPTSDGKYKAFSTCGSHLAVVCLFYGTGLVGYLSSAVLPSPRKSMVASVMYTVVT
PMLNPFIYSLRNKDIQSALCRLHGRIIKSHHLHPFCYMG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,362,336 9,362,336 Del(1) -/G rs34185242 (DbSNP)
19 9,362,297 9,362,297 NS C/T S/F rs12980833 (DbSNP)
19 9,362,443 9,362,443 NS C/T P/S rs2240928 (DbSNP)
19 9,361,767 9,361,767 SYN A/G P/P rs60144766 (DbSNP)
19 9,362,343 9,362,343 SYN C/T S/S rs2240927 (DbSNP)
19 9,251,621 9,251,621 NS C/T S/F 1000GP (CEU, CHBJPT)
19 9,251,767 9,251,767 NS C/T P/S 1000GP (CEU, CHBJPT)
19 9,251,667 9,251,667 SYN C/T S/S 1000GP (CEU, CHBJPT)
19 9,251,091 9,251,091 SYN G/A P/P 1000GP (CHBJPT)
19 100 -100 SYN C/T S/S 1000GP (YRI)
19 100 -100 NS C/T P/S 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T56M I64V S193F P242S % Freq CORP
1 T I S P 48.85 0.347
2 T I S S 39.78 0.347
3 T I F S 6.53 0.347
4 T V S S 4.61 0.347
5 M V S S 0.23 0.347

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E24.aApr07-unspliced main_exon CDS chr19 9,251,044 9,252,060 +
3UTR chr19 9,252,060 9,252,479 +