Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E25P Olfactory Receptor

Gene Symbol OR7E25P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases CIT-B-440L2, OR19-12, OR19-C, HsOR19.2.10P, ORL3781
External Ids HGNC: 8397   GeneBank: AF399401, BK004813, NG_004132   ORDB: ORL3781   
Build #39 labels OR7E25P
Chromosomal location 19:9,204,252-9,205,232 (+)
Cluster 19@9b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E14P 75.23% 323
OR7E19P 74.84% 322
OR7E24 79.82% 327

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 78% 323
Mouse Or7e178 75% 303
Rat Or7e177 71% 291
Cow OR7E186 74% 316
Orang OR7E24P 80% 313
Horse OR7E225 75% 330
Chimp OR7E14P 77% 312

Sequence information

Nucleotide sequence TTTTGTCCTTTCCTTTTTTCCAATTCTCTTTTTCTCAATTGTGTCCAAGATACACAGAGC
CAGAGAATCTCACAGGTGTCTTAGAATTCCTGCTCCTGGGACTCCCAGATGATCCAGAAC
TGCAGCCCGTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCATGGTGCTGGGGAACC
TGCTCATCATTCTGGCCGTCAGCTCTGACTCCCATCTCCACAGCCCCATGTACTTCTTCC
TCTCCAACCTGTCCTTGGCTGACATCGGTTTTGCCTCTACTACTGTCCCCAAGATGATTG
TGGACATCCAGGCTCATAGTAGACTCATCTCTTACGTGGGCTGCCTGACTCAGATGTCTT
TTTTGATCTTTTTCGCATGTATGGAAAGTCTGCTCCTGATTGTGATGGCCTATGACCGGT
TCGTGGCCATCTGTCACCCCCTGCACTACCAAGTCATCATGAGCCCACGACTCTGTGGCT
TCTTAGTTTTGGTGTCTTTTTTTCTTAGCCTTTTGGACTCTCAGCTGCACAATTTGATTG
TGTTACAACTTACCTGCTTCAACGATGTGGAAATCTCTAATTTTTTTCTGTGACCCTTCT
TAACTTCTCAAGCTGGCCTGTTCTGACACCTCCATTAATAACATGGTTGTATATTTTATT
GGTGCCATATTTGGTTTTCTCCCTCTCTTAGGGATCCTTTTCTCTTACTATAAAATTGTT
TCCTCCATTCTGAGAGTTCTCTCTTCAGGTGGGAAGTATAAAGCCTTCTCCACCTGCAGC
TCTCACCTGTCAGTTGTTTGCTTACTTTATGGAACAGCCCTTGGAGGGTACCTCAGTTCA
GCTGTGTCCCTTTCCTCCAGGAAGGGTGCAGTGGCCTCAGTAATGTACATGGTGGTCACC
CCCATGCTGAACCCCTTCATCTACAGCCTGAGAAACAGGGACATTCAAAGTGCCCTGCAG
AGGCTGCACGGCAGAATAATG
Conceptual translation FCPFLFSNSLFLN/CPRYTEPENLTGVLEFLLLGLPDDPELQPVLFGLFLSMYLVMVLG
NLLIILAVSSDSHLHSPMYFFLSNLSLADIGFASTTVPKMIVDIQAHSRLISYVGCLTQM
SFLIFFACMESLLLIVMAYDRFVAICHPLHYQVIMSPRLCGFLVLVSFFLSLLDSQLHNL
IVLQLTCFNDVEISNFF\DPSXLKLACSDTSINNMVVYFIGAIFGFLPLLGILFSYYK
IVSSILRVLSSGGKYKAFSTCSSHLSVVCLLYGTALGGYLSSAVSLSSRKGAVASVMYMV
VTPMLNPFIYSLRNRDIQSALQRLHGRIM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,315,809 9,315,809 SNP A/G rs56742042 (DbSNP)
19 9,205,133 9,205,133 SNP A/G 1000GP (CEU, CHBJPT)
19 9,205,110 9,205,110 SNP A/G 1000GP (CHBJPT)
19 100 -100 SNP A/G 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,295,591 9,317,125 CopyNumber Variation_50243 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.