Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E36P Olfactory Receptor

Gene Symbol OR7E36P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OST024, HsOR13.1.1P, ORL4122
External Ids HGNC: 8409   GeneBank: AF399393, NG_004129, XM_497371   ORDB: ORL4122   
Build #39 labels OR7E36P, OR7E119P
Chromosomal location 13:41,431,264-41,432,258 (-)
Cluster 13@42
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E37P 97.89% 332

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 72% 323
Chimp OR7E38P 90% 323
Chimp OR7E33P 89% 318
Mouse Or7e178 69% 313
Rat Or7e173 67% 310
Cow OR7E186 69% 327
Orang OR7E14P 88% 323
Orang OR7E12P 87% 313
Orang OR7E15P 89% 323
Horse OR7E225 71% 317

Expression evidences

Source Accession
ESTs EC516607

Sequence information

Nucleotide sequence TTACTTGTTTCCGATTTCTCAACCTCTTTTCTAGGCAAAAGGTGTTCAATCTCTACAGAC
CCACAGAATCTAACAGATGTCTCTGTATTCCTCCTCCTAGAACTACAGAGGATCCAGAAC
GGCAGCCGGTCCTCACTGGGCTGTTCCTGTCCATGTGCCTGGTCACGGTGCTGGGGAACC
TGCTCATCATCCTGGCCATCAGCCCTGACTCCCACCTCCACATCCCCATGTACTTCTTCC
TCTCCAACCTGTCCTTGCCTGACATCGGTTTCACCTCCACCACGGTCCCCAAGATGATTG
TGGACATCCAGTCTCACAGCAGAGTCATCTCCTATGCAGGCTGCCTGACTCAGATGTCTC
TCTTTGCCATTTTTGGAGGCATGGAAGAGAGACATGCTCCTGAGTGTGATGGCCTATGAC
CGGTTTGTAGCCATCTGTCACCCTCTATATCATTCAGCCATCATGAACCCGTGTTTCTGT
GGCTTCCTAGTTTTGTTGTCTTTTTTTTTTCTGTCCTCAGTCTTTTAGACTCCCAGCTGC
ACAACTTGATTGCCTTACAAGTGACCTGCTTCAAGGATGTGGAAATTCCTAATTTCTTCT
GTGACCCTTCTCAACTCCCCCATCTTGCATGTTGTGACACCTTCACCAATAAGATAATCA
TGTATTTCCCTGCTGCCATATTTGGTTTTCTTCCCATCTCAGGGACCCTTTTCTCTTACT
CTAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGAAGTATAAAGCCTTCT
CCACCTGTGGGTCTCACCTGTCAGTTGTTTGCTGAGTTTATGGAACAGGCGTTGGAGGTT
ACCTCAGTTCAGATGATGTGTCATCTTCCCCCAGAAAGGGTGCAGTGGCCTCAGTGATGT
ACACGGTGGTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGAAACAGGGATATTA
AAGGTGTCCTGCGGCGGCCGCACGGCAGCACAGTC
Conceptual translation LLVSDFSTSFLGKRCSISTDPQNLTDVSVFLLLEL/EDPERQPVLTGLFLSMCLVTVLG
NLLIILAISPDSHLHIPMYFFLSNLSLPDIGFTSTTVPKMIVDIQSHSRVISYAGCLTQM
SLFAIFGGMEE\MLLSVMAYDRFVAICHPLYHSAIMNPCFCGFLVLLSFFFL/LSLLD
SQLHNLIALQVTCFKDVEIPNFFCDPSQLPHLACCDTFTNKIIMYFPAAIFGFLPISGTL
FSYSKIVSSILRVSSSGGKYKAFSTCGSHLSVVCXYGTGVGGYLSSDDVSSSPRKGAVA
SVMYTVVTPMLNPFIYSLRNRDIKGVLRRPHGSTV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
13 42,005,579 42,005,579 SNP C/A rs17062178 (DbSNP)
13 42,006,229 42,006,229 SNP A/G rs35936691 (DbSNP)
13 42,006,349 42,006,349 SNP A/G rs34585341 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
13 42,003,385 42,007,795 CopyNumber Variation_86805 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E36P.aApr07-unspliced main_exon CDS_partial chr13 41,431,280 41,432,153 -