Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E43P Olfactory Receptor

Gene Symbol OR7E43P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR4-116, OR4-4, HsOR4.1.3P, ORL3122
External Ids HGNC: 8417   GeneBank: BK004733   ORDB: ORL3122   
Build #39 labels OR7E43P
Chromosomal location 4:4,174,321-4,175,290 (-)
Cluster 4@4b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E26P 86.96% 322
OR7E36P 87.77% 327
OR7E37P 87.73% 326

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 68% 323
Mouse Or7e178 66% 310
Rat Or7e173 64% 304
Cow OR7E193 67% 318
Orang OR7E15P 90% 320
Horse OR7E225 69% 314
Chimp OR7E36P 88% 323
Chimp OR7E14P 86% 320
Chimp OR7E33P 86% 316

Sequence information

Nucleotide sequence TTTCAACCCTCTTTTCTAGGCAAAAGGTGTCCAAACTCTACAGACCCACAGAATGTAACG
GATGTCTCTCGATTCCTCCTCCTCAAACTCTCAGAGGATCCAGAACTGCAGCCGGTCCTT
GCTGGGCTGTTCCTGTCCATGTGCCTGGTCACGGTGCTGGGGAACCTGCTCATCATCCTG
GCCGTCAGCCCTGACTCCCACCTCCACACTTCCATGTACTTCTTCCTCTCCAACCTGTCC
TTGCCTGACATCGGTTTCCCCTCCCCCACGGTCCCCAAGATGGTTGTGGACATCCAATCT
CACAGCAGTCATCTCCTATGCAGGCTGCCTGACTCAGATGTCTCTCTTTGCCATTTTTGG
AGGCATGGAAGAGACACATGCTCCTGAATGTGATGGCCTATGTCCGGTTTGTAGCCATCT
GTCACCCTCTATATCATTCAGCCATCATGAACCCGTGTTTCTGTGGCTTCTTACTTTTGT
TGTCTTTTTTTTTTCTCGGTCTTTTAGACGCCCAGCTGCACAACATGATTGCCTTACAAA
TGACCTGCTTCAAGGATGTGGAAATTCCTAATTTCTTCTGTGATCCTTCTCAACTCCCCC
ATCTTGCATGTTGTGACACCTTCACCAATAACATCATCATGTATTTCCCTGCTGCCGTAT
TTGGTTTCCTTCCCATCTCGGGGACCCTTTTCTCTTACTCTAAAATTGTTTCCTCCATTC
TGAGGGTTTCGTCATCAGGTGGGAAGTATAAACCTTCTCCACCTGTGGGTCTCACCTGTC
AGTTTTTTGCTGATTTTATGGAACAGGCATTGGAGGGTACCTCAGTTCAGATGTGTCATC
TTCCCTGAGAAAGGCTGCAGTGGCCTCACTGATGTACAAGATGGTCACCCCCATGCTGAA
CCCCTCCATCTACAGCCTGAGAAACAGGGATATTAAAAGTGTCCTGCGGCAGCCGCACGG
CAGCACGGTC
Conceptual translation FQPSFLGKRCPNSTDPQNVTDVSRFLLLKLSEDPELQPVLAGLFLSMCLVTVLGNLLIIL
AVSPDSHLHTSMYFFLSNLSLPDIGFPSPTVPKMVVDIQSH\VISYAGCLTQMSLFAIF
GGMEE\MLLNVMAYVRFVAICHPLYHSAIMNPCFCGFLLLLSFFFLGLLDAQLHNMIAL
QMTCFKDVEIPNFFCDPSQLPHLACCDTFTNNIIMYFPAAVFGFLPISGTLFSYSKIVSS
ILRVSSSGGKYK/FSTCGSHLSVFCXYGTGIGGYLSSDVSSSLRKAAVASLMYKMVTP
MLNPSIYSLRNRDIKSVLRQPHGSTV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
4 100 -100 SNP T/A 1000GP (YRI, YRI)
4 4,174,560 4,174,560 SNP C/T 1000GP (CHBJPT)
4 4,174,616 4,174,616 SNP T/A 1000GP (CEU, CHBJPT)
4 4,176,067 4,176,067 SNP C/T rs12501414 (DbSNP)
4 4,176,085 4,176,085 SNP A/C rs28681234 (DbSNP)
4 4,176,201 4,176,201 SNP A/C rs28375212 (DbSNP)
4 4,176,209 4,176,209 SNP C/T rs11933759 (DbSNP)
4 4,176,287 4,176,287 SNP C/T rs12499056 (DbSNP)
4 4,176,343 4,176,343 SNP A/T rs62290061 (DbSNP)
4 4,176,703 4,176,703 SNP A/G rs2887349 (DbSNP)
4 4,176,712 4,176,711 Ins(2) -/CT rs35002176 (DbSNP)
4 4,176,735 4,176,735 SNP C/T rs2887350 (DbSNP)
4 4,176,903 4,176,903 SNP C/T rs28603313 (DbSNP)
4 4,176,905 4,176,905 SNP A/G rs2887351 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 67 (Hasin)
4 3,394,344 4,350,986 CopyNumber Variation_3477 (DGV)
4 3,823,172 4,262,068 InversionBreakpoint Variation_0346 (DGV)
4 3,923,728 4,199,760 CopyNumber Variation_51403 (DGV)
4 3,950,135 4,187,960 CopyNumber Variation_91887 (DGV)
4 4,122,303 4,187,960 CopyNumber Variation_80153 (DGV), Variation_91888 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.