Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E84P Olfactory Receptor

Gene Symbol OR7E84P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OST185, HsOR4.2.2P, ORL3119
External Ids HGNC: 14690   ORDB: ORL3119   
Build #39 labels OR7E84P, OR7E54P
Chromosomal location 4:9,469,023-9,469,980 (+)
Cluster 4@9
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E126P 91.88% 320
OR7E148P 90.94% 320
OR7E59P 89.38% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E153 69% 311
Mouse Or7e178 63% 317
Rat Or7e173 62% 312
Cow OR7E186 68% 314
Orang OR7E12P 85% 317
Orang OR7E53P 85% 317
Orang OR7E84BP 83% 320
Orang OR7E14P 83% 320
Horse OR7E225 66% 318
Chimp OR7E53P 88% 320
Chimp OR7E55P 88% 317

Expression evidences

Source Accession
ESTs AA815433
GNF Atlas2 gnf1h10282_x_at

Sequence information

Nucleotide sequence AACGATACAGACCCACAGAGTCTAACAGATGTCTCTATATTCCTCCTCCTCGAACTCTCA
GAGGATCCAGAACTGCAGCCGGTCATCGCTGGGCTGTTCCTGTCCATGTGCCTGGTCACG
GTGCTGGGGAACCTGCTCATCATCATGGCAGTCAGCCCTGACTTCCACCTCCACACCCCC
ATGTACTTCTTCCTCTCCAACCTGTCCTTGCCTGACATCGGTTTCACCTCCACACGGTCC
CCAAGATGATTGTGGACATCCAGTCTCACAGCAGAGTCATCTCCTATGCAGGCTGCCTGA
CTCAGATGTCTCTCTTTGCCATTTTTGGAGGCATGGAAGAGACACATGCTCCTGAGCGTG
ATGGCCTACGACCAGTTTGTAGCCATCTGTCACCCTCCATATCGTTCAGCCATCTTGAAC
CCGTGTTTCTGTAGCTTCCAAGATTTGTTGTCCTTGTTTTTTTTCTTTTTTTTTTTCTTT
TTTTCCTCAGGCTTTTAGACTCCCAGCTGCATAACTTGATTGCCTTACAAATGACCTGCT
TCAAGGATGTGGAAATTTCTAATGTCTTCTGGGAACCTTCTCAACTCCCCCATCTTGCAT
GTTGTGACACCTTCACCAGGAACATCAACCTGTATTTCCCTGCTGCCGTATTGGGTTTTC
TTCCCATCTCGGGGACGCTTTTCTCTTACTGTAAAATTGTTTCCTCCATTCTGAGGGTTT
CATCATCAGGTGGGAAGTATAAACCTTCTCCACCTGTGGGTCTCACCTGTCTGCTGTTTG
CTGATTTTATGGAACAGGCGTTGGAGGGTATCTCGGTTCAGATGTGTCATCTTCCCCGAG
AAAGAGTGCAGTGGCCTCAGTGATGTATACGGTGGTCACCCCCATGCTGAACCCCTTCAT
CTACAGCCTGAGAAACAGGGATATGAAAAGTGTCCTGCGGCGGCCGCACAGCAGCACGGT
C
Conceptual translation NDTDPQSLTDVSIFLLLELSEDPELQPVIAGLFLSMCLVTVLGNLLIIMAVSPDFHLHTP
MYFFLSNLSLPDIGFTS/TVPKMIVDIQSHSRVISYAGCLTQMSLFAIFGGMEE\MLL
SVMAYDQFVAICHPPYRSAILNPCFCSFQ\CCPCFFSFFF\FFLRLLDSQLHNLIALQ
MTCFKDVEISNVFWEPSQLPHLACCDTFTRNINLYFPAAVLGFLPISGTLFSYCKIVSSI
LRVSSSGGKYK/FSTCGSHLSAVCXYGTGVGGYLGSDVSSSPRKSAVASVMYTVVTPM
LNPFIYSLRNRDMKSVLRRPHSSTV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
4 100 -100 SNP T/C 1000GP (YRI)
4 9,470,876 9,470,876 SNP A/G rs6823649 (DbSNP)
4 9,470,880 9,470,880 SNP C/A rs4974836 (DbSNP)
4 9,471,091 9,471,091 SNP C/G rs13435676 (DbSNP)
4 9,471,181 9,471,181 SNP A/G rs13435825 (DbSNP)
4 9,471,213 9,471,213 SNP T/C rs4974903 (DbSNP)
4 9,471,214 9,471,214 SNP T/C rs4974902 (DbSNP)
4 9,471,225 9,471,225 SNP T/C rs4974901 (DbSNP)
4 9,471,399 9,471,399 SNP C/T rs73100120 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 45 (Hasin)
4 8,522,173 10,273,779 CopyNumber Variation_3479 (DGV)
4 8,705,921 9,811,805 CopyNumber Variation_2497 (DGV)
4 8,707,676 9,852,717 InversionBreakpoint Variation_0347 (DGV)
4 8,732,308 9,471,295 CopyNumber Variation_80181 (DGV), Variation_91924 (DGV)
4 9,324,682 9,496,122 CopyNumber Variation_68668 (DGV)
4 9,370,309 9,479,149 CopyNumber Variation_4378 (DGV)
4 9,371,116 9,486,579 CopyNumber Variation_59613 (DGV)
4 9,371,116 9,513,465 CopyNumber Variation_9469 (DGV), Variation_51485 (DGV), Variation_53971 (DGV)
4 9,371,116 9,573,740 CopyNumber Variation_51486 (DGV)
4 9,371,116 9,599,790 CopyNumber Variation_53853 (DGV)
4 9,371,116 9,719,981 CopyNumber Variation_9470 (DGV)
4 9,379,592 9,513,465 CopyNumber Variation_51488 (DGV)
4 9,381,818 9,681,651 CopyNumber Variation_34433 (DGV)
4 9,400,938 9,594,059 CopyNumber Variation_0699 (DGV), Variation_2069 (DGV)
4 9,438,587 9,485,225 CopyNumber Variation_36313 (DGV)
4 9,442,659 9,497,345 CopyNumber Variation_36314 (DGV)
4 9,442,758 9,488,227 CopyNumber Variation_36315 (DGV)
4 9,449,613 9,499,818 CopyNumber Variation_36316 (DGV)
4 9,453,202 9,479,541 CopyNumber Variation_68671 (DGV)
4 9,461,230 9,479,345 CopyNumber Variation_38824 (DGV)
4 9,470,649 9,473,709 Deletion #5 (Waszak)
4 9,471,387 9,476,570 CopyNumber Variation_31162 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.