Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E99P Olfactory Receptor

Gene Symbol OR7E99P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR4-3, HsOR4.1.2P, ORL3124
External Ids HGNC: 15059   GeneBank: AF399415, BK004561, NG_004262   ORDB: ORL3124   
Build #39 labels OR7E99P
Chromosomal location 4:4,156,479-4,157,503 (-)
Cluster 4@4b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
91.81% 342
OR7E129P 92.69% 342
OR7E87P 92.65% 340

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 66% 331
Mouse Or7e178 64% 310
Rat Or7e173 58% 310
Cow OR7E186 64% 329
Orang OR7E103P 91% 307
Orang OR7E163P 91% 298
Orang OR7E163RP 91% 298
Horse OR7E225 67% 318
Chimp OR7E163P 90% 319
Chimp OR7E161P 90% 319
Chimp OR7E7P 92% 307
Chimp OR7E115P 88% 319

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTCCTTCTCAAGGTGTCCAAGACACACA
GAGCCACGGAATCACACAGGGGTCTGAGAATTTCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCGGTCCTCGCTTTGCTGTCCCTGTCCCTGTCCATGTATCTGGTCACGGTG
CTGAGGAACCTGCTCAGCATCCTGGCTGTCCGCTCTGACTCCCCCCTCCACAACCCCATG
TACTTCTTCCTCTCCAACCTGTGCTGGGCTGACATCGGTTTCACCTCGGCCACGGTTGCC
AAGATGATTGTGGAATGCAGTCGCATAGCAGAGTCATCTCTCATGCGGGCTGCCTGACGC
AGATGTCTTTCTTGGTCCTTTTTGCATGTATAGAAGGCATGCTCCTGACTGTGATGGCCT
ATGACTGCTTTGTAGCCATCTGTCGTCCTCTGCACTACCCAGTCATCGTGAATCCTCACC
TCTGTGTCTTCTTCGTTTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCACA
GTTCGATTGTGTTACAATTCACCATCATCAAGAATGTGGAAATCTCTCATTTTGTCTGTG
ACCCCTCTCATCTTCTCAAACTTGCCTGTTCTGACAGCGTCATCAATAGCATATTCATAT
ATTTCGATAGTACTATGTTTGGTTTTCTTCCCATTTCAGGGATCCTTTGGTCTTACTATA
AAATCGTCCCCTCCATTCTAAGGATTTCATCATCAGATGGGAAGTATAAAGCCTTCGCCA
CCTGTGGCTCTCACCTAGCAGTTGTTTGCTGATTTGATGGAACAGGCATTGGTATGTACC
TGACTTCAGCTGTGGCACCACCCCCTAGGAATGGAGTGGTGGCATCAGTGATGTAGGCTG
TGGTCACCCCCATGCTGAACCTTTTCATCTACAGCCTGAGAAACAGGGACATACAAAGTG
CCCTGCGGAGGCTGCTCAGCAGAACAGTCGAATTTCATGATCTGTTTCATTCTTTTTCTT
GTGTG
Conceptual translation LVFIFYFSNPLSFSRCPRHTEPRNHTGVXFLLLGLSEDPELQPVLALLSLSLSMYLVTV
LRNLLSILAVRSDSPLHNPMYFFLSNLCWADIGFTSATVAKMIV/MQSHSRVISHAGCL
TQMSFLVLFACIEGMLLTVMAYDCFVAICRPLHYPVIVNPHLCVFFVLVSFFLSLLDSQL
HSSIVLQFTIIKNVEISHFVCDPSHLLKLACSDSVINSIFIYFDSTMFGFLPISGILWSY
YKIVPSILRISSSDGKYKAFATCGSHLAVVCXDGTGIGMYLTSAVAPPPRNGVVASVMXbr/>AVVTPMLNLFIYSLRNRDIQSALRRLLSRTVEFHDLFHSFSCV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
4 100 -100 SNP A/G 1000GP (YRI)
4 4,130,633 4,130,633 large insertion 29491bp insertion rs72482072 (DbSNP)
4 4,156,627 4,156,627 SNP A/T 1000GP (CEU)
4 4,156,638 4,156,638 SNP A/G 1000GP (CEU)
4 4,156,671 4,156,671 SNP A/G 1000GP (CEU)
4 4,156,967 4,156,967 SNP G/A 1000GP (CEU)
4 4,158,255 4,158,255 SNP A/C rs62288330 (DbSNP)
4 4,158,365 4,158,365 SNP A/G rs9799690 (DbSNP)
4 4,158,398 4,158,398 SNP A/G rs9799691 (DbSNP)
4 4,158,434 4,158,434 SNP C/T rs57779269 (DbSNP)
4 4,158,620 4,158,620 SNP A/T rs35462216 (DbSNP)
4 4,158,736 4,158,736 SNP C/T rs3952914 (DbSNP)
4 4,158,785 4,158,785 SNP A/G rs1865327 (DbSNP)
4 4,158,786 4,158,786 SNP C/T rs4018318 (DbSNP)
4 4,158,829 4,158,829 SNP A/G rs3952915 (DbSNP)
4 4,158,834 4,158,834 SNP C/T rs3952916 (DbSNP)
4 4,158,842 4,158,842 SNP A/G rs3928156 (DbSNP)
4 4,158,856 4,158,856 SNP A/C rs4081930 (DbSNP)
4 4,158,885 4,158,885 SNP A/G rs9714982 (DbSNP)
4 4,158,933 4,158,933 SNP C/G rs4018319 (DbSNP)
4 4,158,998 4,158,998 SNP G/T rs4018320 (DbSNP)
4 4,159,176 4,159,176 SNP C/G rs4018321 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
4 3,394,344 4,350,986 CopyNumber Variation_3477 (DGV)
4 3,823,172 4,262,068 InversionBreakpoint Variation_0346 (DGV)
4 3,923,728 4,199,760 CopyNumber Variation_51403 (DGV)
4 3,950,135 4,187,960 CopyNumber Variation_91887 (DGV)
4 4,106,532 4,168,877 CopyNumber Variation_36272 (DGV)
4 4,113,336 4,170,143 CopyNumber Variation_80152 (DGV)
4 4,122,303 4,187,960 CopyNumber Variation_80153 (DGV), Variation_91888 (DGV)
4 4,125,292 4,164,133 CopyNumber Variation_91889 (DGV)
4 4,137,250 4,161,240 CopyNumber Variation_80154 (DGV), Variation_91890 (DGV)
4 4,156,206 4,159,330 Deletion #9 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.