Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7G1 Olfactory Receptor

Gene Symbol OR7G11 (View this gene in GeneCards)
Family 7
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR19-15, OR19-8, HsOR19.2.5, ORL3762
External Ids HGNC: 8465   GeneBank: AB065926, AF399538, BK004267, NM_001005192   ORDB: ORL3762   
Build #39 labels OR7G1
Chromosomal location 19:9,114,831-9,115,763 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7G2 74.35% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7G8 79% 308
Chimp CONTIG875.6-1313 97% 311
Mouse Or7g16 67% 307
Rat Or7g17 67% 311
Cow OR7G8 78% 307

Sequence information

Nucleotide sequence ATGGGACCCAGAAACCAAACAGCTGTTTCAGAATTTCTTCTCATGAAAGTGACAGAGGAC
CCAGAACTGAAGTTAATCCCTTTCAGCCTGTTCCTGTCCATGTACCTGGTCACCATCCTG
GGGAACCTGCTCATTCTCCTGGCTGTCATCTCTGACTCCCACCTCCACACCCCCATGTAC
TTCCTTCTCTTTAATCTCTCCTTTACTGACATCTGTTTAACCACAACCACAGTCCCAAAG
ATCCTAGTGAACATCCAAGCTCAGAATCAGAGTATCACTTACACAGGCTGCCTCACCCAG
ATCTGTCTTGTCTTGGTTTTTGCTGGCTTGGAAAGTTGCTTTCTTGCAGTCATGGCCTAC
GACCGCTATGTGGCCATTTGCCACCCACTGAGGTACACAGTCCTCATGAATGTCCATTTC
TGGGGCTTGCTGATTCTTCTCTCCATGTTCATGAGCACTATGGATGCCCTGGTTCAGAGT
CTGATGGTATTGCAGCTGTCCTTCTGCAAAAACGTTGAAATCCCTTTGTTCTTCTGTGAA
GTCGTTCAGGTCATCAAGCTCGCCTGTTCTGACACCCTCATCAACAACATCCTCATATAT
TTTGCAAGTAGTGTATTTGGTGCAATTCCTCTCTCTGGAATAATTTTCTCTTATTCTCAA
ATAGTCACCTCTGTTCTGAGAATGCCATCAGCAAGAGGAAAGTATAAAGCGTTTTCCACC
TGTGGCTGTCACCTCTCTGTTTTTTCCTTGTTCTATGGGACAGCTTTTGGGGTGTACATT
AGTTCTGCTGTTGCTGAGTCTTCCCGAATTACTGCTGTGGCTTCAGTGATGTACACTGTG
GTCCCTCAAATGATGAACCCCTTCATCTACAGCCTGAGAAATAAGGAGATGAAGAAAGCT
TTGAGGAAACTTATTGGTAGGCTGTTTCCTTTT
Conceptual translation MGPRNQTAVSEFLLMKVTEDPELKLIPFSLFLSMYLVTILGNLLILLAVISDSHLHTPMY
FLLFNLSFTDICLTTTTVPKILVNIQAQNQSITYTGCLTQICLVLVFAGLESCFLAVMAY
DRYVAICHPLRYTVLMNVHFWGLLILLSMFMSTMDALVQSLMVLQLSFCKNVEIPLFFCE
VVQVIKLACSDTLINNILIYFASSVFGAIPLSGIIFSYSQIVTSVLRMPSARGKYKAFST
CGCHLSVFSLFYGTAFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKA
LRKLIGRLFPF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,225,940 9,225,940 NS A/G F/S rs7246969 (DbSNP)
19 9,226,192 9,226,192 NS A/G V/A rs6511874 (DbSNP)
19 9,225,694 9,225,694 NS A/G F/S rs28599881 (DbSNP)
19 9,225,973 9,225,973 NS A/G V/A rs7246980 (DbSNP)
19 9,226,017 9,226,017 NS C/G W/C rs2217657 (DbSNP)
19 9,225,685 9,225,685 NS T/C Y/C rs2195951 (DbSNP)
19 9,115,516 9,115,516 NS A/G V/A 1000GP (CEU, CHBJPT)
19 9,115,341 9,115,341 NS C/G W/C 1000GP (CEU, CHBJPT)
19 9,115,009 9,115,009 NS T/C Y/C 1000GP (CEU, CHBJPT)
19 9,115,264 9,115,264 NS G/A S/F 1000GP (CEU, CHBJPT)
19 9,115,297 9,115,297 NS G/A A/V 1000GP (CEU)
19 100 -100 NS T/C Y/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y252C V182I S167F A156V W141C P129T R122H V83A M59V % Freq CORP
1 Y V S A W P R V M 51.69 0.169
2 C V S A C P R A M 31.41 0.052
3 Y V S A C P R V M 10.37 0.169
4 Y V F V C P R V M 3.61 0.169
5 C V S A C T R A M 1.00 0.104
6 Y V F V W P R V V 0.61 0.630
7 C V S A C P R V M 0.31 0.052
8 Y V S A C P R A M 0.31 0.169
9 Y V F V C P R A M 0.23 0.169
10 C V S A C P H A M 0.08 0.492
11 Y V F V W P R V M 0.08 0.169
12 C V S A C P R A V 0.08 0.312
13 Y V F A C P R V M 0.08 0.169
14 Y I S A C P R V M 0.08 0.169
15 Y V S A W P R A M 0.08 0.169

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7G1.aApr07 exon_3UTR chr19 9,114,598 9,114,683 -