Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7G15P Olfactory Receptor

Gene Symbol OR7G15P1 (View this gene in GeneCards)
Family 7
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR19.2.6P
External Ids HGNC: 31313   GeneBank: NG_004437   
Build #39 labels
Chromosomal location 19:9,122,084-9,122,487 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks Disrupted by Alu repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7C1 57.39% 115
OR7G1 64.91% 114
OR7G2 60% 125

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7G9 64% 117
Mouse Or7g19 59% 116
Rat Or7g24 56% 124
Cow OR7G8 66% 116
Orang OR7G1P 61% 123
Horse OR7G67 61% 116
Chimp OR7G1 64% 114

Sequence information

Nucleotide sequence TAAATAAAAATAACTTTCTGGTCTATTTTGCAACTTGCATATTTGGTGATATTCTTCTCT
CTGGGGTCATGTTTTCTTATTCTCAAATAGCCTTGTCTGTTTTGAGAATGCCGTCAGCAA
GTAATAAAGCTTTTTTCAGCTGTGAGTCTCACCTCCCATTTGTTTCCCGATTCTACAGGG
CGGGTTGGGGGGTGTACATTAGCTCTGCCGTTTCTGACTCTTCAAGGAGGGCTGCGGTGG
CTTCAGTGATGTACACAGTGGTCACACCTATTATGAACCCCTTTATCTACAGCCTGAGGA
ACAGAGATATGAAGAGAGCCTCGGGGAAACTCATTGGTAGGATAACTTCTCTTCCTGATT
ATGTTGTCCACTTTGGACTTGGGATTCAAAGTGGGTCAAAGACA
Conceptual translation INKNNFLVYFATCIFGDILLSGVMFSYSQIALSVLRMPSASNKAFFSCESHLPFVSRFYR
AGWGVYISSAVSDSSRRAAVASVMYTVVTPIMNPFIYSLRNRDMKRASGKLIGRITSLPD
YVVHFGLGIQSGSKT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,233,159 9,233,159 Del(1) -/A rs5827049 (DbSNP)
19 9,232,933 9,232,933 SNP C/T rs4578779 (DbSNP)
19 9,232,773 9,232,773 SNP C/T rs4395187 (DbSNP)
19 9,233,025 9,233,025 SNP C/T rs7251129 (DbSNP)
19 9,122,097 9,122,097 SNP C/T 1000GP (CEU, CHBJPT)
19 9,122,257 9,122,257 SNP C/T 1000GP (CEU, CHBJPT)
19 9,122,166 9,122,166 SNP G/A 1000GP (CHBJPT)
19 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,230,760 9,233,263 Deletion #245 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.