Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7G2 Olfactory Receptor

Gene Symbol OR7G21 (View this gene in GeneCards)
Family 7
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.2 (functional)
Aliases OR19-6, OST260, HsOR19.2.4, ORL3771
External Ids HGNC: 8466   GeneBank: AB065927, AF399539, BK004268, NM_001005193   ORDB: ORL3771   
Build #39 labels OR7G2
Chromosomal location 19:9,102,272-9,103,243 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7G1 74.35% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7G8 75% 312
Chimp CONTIG875.6-1313 73% 308
Chimp CONTIG9931.2-918 69% 310
Chimp CONTIG1211.27-12914 64% 304
Mouse Or7g34 73% 312
Rat Or7g34 71% 311
Cow OR7G8 75% 312

Expression evidences

Source Accession
GNF Atlas2 gnf1h03473_at

Sequence information

Nucleotide sequence ATGGAAGCGAGAAACCAAACAGCTATTTCAAAATTCCTTCTCCTGGGACTGATAGAGGAT
CCGGAACTGCAGCCCGTCCTTTTCAGCCTGTTCCTGTCCATGTACTTGGTCACCATCCTG
GGGAACCTGCTCATCCTCTTGGCTGTCATCTCTGACTCTCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAATCTCTCCTTTTTGGACATTTGTTTAAGCACAACCACGATCCCAAAG
ATGCTGGTGAACATCCAAGCTCAGAATCGGAGCATCACGTACTCAGGCTGCCTCACCCAG
ATCTGCTTTGTCTTGTTTTTTGCTGGCTTGGAAAATTGTCTCCTTGCAGCAATGGCCTAT
GACCGCTATGTGGCCATTTGTCACCCCCTTAGATACACAGTCATCATGAACCCCCGCCTC
TGTGGCCTGCTGATTCTTCTCTCTCTGTTGACTAGTGTTGTGAATGCCCTTCTTCTCAGC
CTGATGGTGTTGAGGCTGTCCTTCTGCACAGACCTGGAAATCCCGCTCTTCTTCTGTGAA
CTGGCTCAGGTCATCCAACTCACCTGTTCAGACACCCTCATCAATAACATCCTGATATAT
TTTGCAGCTTGCATATTTGGTGGTGTTCCTCTGTCTGGAATCATTTTGTCTTACACTCAG
ATCACCTCCTGTGTTTTGAGAATGCCATCAGCAAGTGGAAAGCACAAAGCAGTTTCCACC
TGTGGGTCTCACCTCTCCATTGTTCTCTTGTTCTATGGGGCAGGTTTGGGGGTGTACATT
AGTTCTGTGGTTACTGACTCACCTAGGAAGACTGCAGTGGCTTCAGTGATGTATTCTGTG
TTCCCTCAAATGGTGAACCCCTTTATCTATAGTCTGAGGAATAAGGACATGAAAGGAACC
TTGAGGAAGTTCATAGGGAGGATACCTTCTCTTCTGTGGTGTGCCATTTGCTTTGGATTC
AGGTTTCTAGAG
Conceptual translation MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMY
FFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAY
DRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCE
LAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVST
CGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGT
LRKFIGRIPSLLWCAICFGFRFLE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,213,182 9,213,181 Ins(1) -/G rs35907822 (DbSNP)
19 9,213,079 9,213,079 NS A/C F/V rs4804401 (DbSNP)
19 9,213,132 9,213,132 NS A/G V/A rs12610094 (DbSNP)
19 9,213,396 9,213,396 NS A/G L/P rs7247751 (DbSNP)
19 9,213,651 9,213,651 NS C/T R/Q rs62621389 (DbSNP)
19 9,213,026 9,213,026 SYN C/T K/K rs4804400 (DbSNP)
19 9,102,456 9,102,456 NS A/G V/A 1000GP (CEU, CHBJPT)
19 9,102,350 9,102,350 SYN T/C K/K 1000GP (CEU, CHBJPT)
19 9,102,975 9,102,975 NS C/T R/Q 1000GP (CEU, CHBJPT)
19 9,102,403 9,102,403 NS A/C F/V 1000GP (CEU, CHBJPT)
19 100 -100 SYN T/C K/K 1000GP (YRI)
19 100 -100 NS A/C F/V 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 192 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F302V V284A A275S P196L R111Q % Freq CORP
1 F V A P R 55.22 0.415
2 V A A P R 35.56 0.415
3 F V A L R 3.46 0.415
4 F A A P Q 3.00 0.415
5 F A A P R 2.15 0.415
6 V A S P R 0.46 0.415
7 V V A P R 0.15 0.415

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7G2.aApr07-unspliced main_exon 3UTR chr19 9,102,269 9,102,272 -
CDS chr19 9,102,272 9,103,243 -
5UTR chr19 9,103,243 9,103,306 -