Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7G3 Olfactory Receptor

Gene Symbol OR7G31 (View this gene in GeneCards)
Family 7
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR19-9, OST085, HsOR19.2.7, ORL37465
External Ids HGNC: 8467   GeneBank: AB065932, AF399540, BK004266, NM_001001958   ORDB: ORL37465   
Build #39 labels OR7G3
Chromosomal location 19:9,126,015-9,126,950 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7D4 65.16% 310
OR7G1 67.1% 307
OR7G2 68.39% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7G3 83% 312
Chimp CONTIG9931.2-918 96% 311
Mouse Or7g12 78% 310
Rat Or7g12 77% 310
Cow OR7G7 72% 305

Expression evidences

Source Accession
GNF Atlas2 gnf1h11268_at

Sequence information

Nucleotide sequence ATGAAAGCAGGAAACTTCTCAGACACTCCAGAATTCTTTCTCTTGGGATTGTCAGGGGAT
CCGGAGCTGCAGCCCATCCTCTTCATGCTGTTCCTGTCCATGTACCTGGCCACAATGCTG
GGGAACCTGCTCATCATCCTGGCCGTCAACTCTGACTCCCACCTCCACACCCCCATGTAC
TTCCTCCTCTCTATCCTGTCCTTGGTCGACATCTGTTTCACCTCCACCACGATGCCCAAG
ATGCTGGTGAACATCCAGGCACAGGCTCAATCCATCAATTACACAGGCTGCCTCACCCAA
ATCTGCTTTGTCCTGGTTTTTGTTGGATTGGAAAATGGAATTCTGGTCATGATGGCCTAT
GATCGATTTGTGGCCATCTGTCACCCACTGAGGTACAATGTCATCATGAACCCCAAACTC
TGTGGGCTGCTGCTTCTGCTGTCCTTCATCGTTAGTGTCCTGGATGCTCTGCTGCACACG
TTGATGGTGCTACAGCTGACCTTCTGCATAGACCTGGAAATTCCCCACTTTTTCTGTGAA
CTAGCTCATATTCTCAAGCTCGCCTGTTCTGATGTCCTCATCAATAACATCCTGGTGTAT
TTGGTGACCAGCCTGTTAGGTGTTGTTCCTCTCTCTGGGATCATTTTCTCTTACACACGA
ATTGTCTCCTCTGTCATGAAAATTCCATCAGCTGGTGGAAAGTATAAAGCTTTTTCCATC
TGCGGGTCACATTTAATCGTTGTTTCCTTGTTTTATGGAACAGGGTTTGGGGTGTACCTT
AGTTCTGGGGCTACCCACTCCTCCAGGAAGGGTGCAATAGCATCAGTGATGTATACCGTG
GTCACCCCCATGCTGAACCCACTCATTTACAGCCTGAGAAACAAGGACATGTTGAAGGCT
TTGAGGAAACTAATATCTAGGATACCATCTTTCCAT
Conceptual translation MKAGNFSDTPEFFLLGLSGDPELQPILFMLFLSMYLATMLGNLLIILAVNSDSHLHTPMY
FLLSILSLVDICFTSTTMPKMLVNIQAQAQSINYTGCLTQICFVLVFVGLENGILVMMAY
DRFVAICHPLRYNVIMNPKLCGLLLLLSFIVSVLDALLHTLMVLQLTFCIDLEIPHFFCE
LAHILKLACSDVLINNILVYLVTSLLGVVPLSGIIFSYTRIVSSVMKIPSAGGKYKAFSI
CGSHLIVVSLFYGTGFGVYLSSGATHSSRKGAIASVMYTVVTPMLNPLIYSLRNKDMLKA
LRKLISRIPSFH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,236,706 9,236,705 Ins(5) -/GGTAT rs3029651 (DbSNP)
19 9,236,707 9,236,706 Ins(5) -/GGTAT rs34694385 (DbSNP)
19 9,237,263 9,237,263 nonsense SNP A/G */R rs17001893 (DbSNP)
19 9,236,969 9,236,969 nonsense SNP G/A R/* rs61751875 (DbSNP)
19 9,236,917 9,236,917 NS A/G V/A rs61730387 (DbSNP)
19 9,237,542 9,237,542 NS C/T V/M rs10414255 (DbSNP)
19 9,237,436 9,237,436 NS G/A S/F rs61745558 (DbSNP)
19 9,236,888 9,236,888 NS T/C I/V rs61730396 (DbSNP)
19 9,237,435 9,237,435 SYN A/G S/S rs10407484 (DbSNP)
19 9,236,886 9,236,886 SYN A/G V/V rs10424352 (DbSNP)
19 9,126,759 9,126,759 SYN A/G S/S 1000GP (CEU, CHBJPT)
19 9,126,654 9,126,654 SYN G/A T/T 1000GP (CEU)
19 9,126,866 9,126,866 NS T/C M/V 1000GP (CEU, CHBJPT)
19 9,126,210 9,126,210 SYN A/G V/V 1000GP (CEU, CHBJPT)
19 9,126,048 9,126,048 NS C/G L/F 1000GP (CHBJPT)
19 9,126,212 9,126,212 NS C/T V/I 1000GP (CHBJPT)
19 9,126,293 9,126,293 nonsense SNP G/A R/* 1000GP (CHBJPT)
19 9,126,760 9,126,760 NS G/A S/F 1000GP (CHBJPT)
19 9,126,781 9,126,781 NS G/T T/N 1000GP (CHBJPT)
19 9,126,843 9,126,843 SYN C/T L/L 1000GP (CHBJPT)
19 9,126,946 9,126,946 NS T/C K/R 1000GP (CHBJPT)
19 100 -100 SYN A/G V/V 1000GP (YRI, YRI, YRI)
19 100 -100 NS C/T V/I 1000GP (YRI, YRI, YRI, YRI)
19 100 -100 nonsense SNP G/A R/* 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,234,691 9,237,726 Deletion #246 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L301F V247I R220* L172V R122* T57N M29V K2R % Freq CORP
1 L V R L R T M K 54.45 0.239
2 L V R L R T V K 38.63 0.239
3 L I * L R T V R 2.38 1.200
4 L V R L * T M K 1.77 1.200
5 L I * L R N V R 1.08 1.200
6 L I * L R T V K 0.54 1.200
7 F V R L R T V K 0.54 0.239
8 L I * L R N M R 0.23 1.200
9 L V * L R N V R 0.08 1.200
10 L I R L R T V K 0.08 0.286
11 L V R V R T V K 0.08 0.239
12 L V R L * T V K 0.08 1.200
13 L V R L R T M R 0.08 0.239

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7G3.aApr07-unspliced main_exon 3UTR chr19 9,126,012 9,126,015 -
CDS chr19 9,126,015 9,126,950 -