Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8B2 Olfactory Receptor

Gene Symbol OR8B21 (View this gene in GeneCards)
Family 8
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.83 (pseudogene)
Aliases OR11-309, AC002556-C, HsOR11.18.33, ORL3456
External Ids HGNC: 8471   GeneBank: AB065826, AF399508, BC018065, BK004500, NM_001005468   ORDB: ORL3456   
Build #39 labels OR8B2
Chromosomal location 11:124,382,405-124,383,343 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B3 97.76% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8B3 89% 313
Chimp CONTIG497.51-14942 97% 313
Chimp CONTIG*********** 97% 313
Mouse Or8b3 82% 313
Rat Or8b3c 83% 313
Rat Or8b3 83% 313
Cow OR8B3 86% 314
Cow OR8B3G 85% 310

Expression evidences

Source Accession
ESTs DN914774
mRNA BC018065

Sequence information

Nucleotide sequence ATGCTGGCTAGAAACAACTCCTTAGTGACTGAATTTATTCTTGCTGGATTAACAGATCAT
CCAGAGTTCCGGCAACCCCTCTTTTTCCTGTTTCTAGTGATCTACATTGTCACCATGGTA
GGCAACCTTGGCTTGATCACTCTTTTCGGTCTAAATTCTCACCTCCACACACCAATGTAC
TATTTCCTCTTCAATCTCTCCTTCATTGATCTCTGTTACTCCTCTGTTTTCACTCCCAAA
ATGCTAATGAACTTTGTGTCAAAAAAGAATATTATCTCCAATGTTGGGTGCATGACTCGG
CTGTTTTTCTTTCTCTTTTTCGTCATCTCTGAATGTTACATGTTGACTTCAATGGCATAT
GATCGCTATGTGGCCATCTGTAATCCATTGCTGTATAAGGTCACCATGTCCCATCAGGTC
TGTTCTATGCTCACTTTTGCTGCTTACATAATGGGATTGGCTGGAGCCACGGCCCACACC
GGGTGCATGCTTAGACTCACCTTCTGCAGTGCTAATATCATCAACCATTACTTGTGTGAC
ATACTCCCCCTCCTCCAGCTTTCCTGCACCAGCACCTATGTCAACGAGGTGGTTGTTCTC
ATTGTTGTGGGTACTAATATCACGGTACCCAGTTGTACCATCCTCATTTCTTATGTTTTC
ATTGTCACTAGCATTCTTCATATCAAATCCACTCAAGGAAGATCAAAAGCCTTCAGTACT
TGTAGCTCTCATGTCATTGCTCTGTCTCTGTTTTTTGGGTCAGCGGCATTCATGTATATT
AAATATTCTTCTGGATCTATGGAGCAGGGAAAAGTTTCTTCTGTTTTCTACACTAATGTG
GTGCCCATGCTCAATCCCCTCATCTACAGTTTGAGGAACAAGGATGTCAAAGTTGCACTG
AGGAAAGCTCTGATTAAAATTCAGAGGAGAAATATATTC
Conceptual translation MLARNNSLVTEFILAGLTDHPEFRQPLFFLFLVIYIVTMVGNLGLITLFGLNSHLHTPMY
YFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISNVGCMTRLFFFLFFVISECYMLTSMAY
DRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCD
ILPLLQLSCTSTYVNEVVVLIVVGTNITVPSCTILISYVFIVTSILHIKSTQGRSKAFST
CSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVAL
RKALIKIQRRNIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A L/F 1000GP (YRI, YRI)
11 100 -100 SYN A/G F/F 1000GP (YRI)
11 124,252,382 124,252,382 SYN A/G P/P rs2320232 (DbSNP)
11 124,252,422 124,252,422 NS A/G F/S rs503220 (DbSNP)
11 124,252,617 124,252,617 NS G/A T/M rs470202 (DbSNP)
11 124,252,626 124,252,626 NS A/G I/T rs470625 (DbSNP)
11 124,252,718 124,252,718 SYN A/G I/I rs886201 (DbSNP)
11 124,252,750 124,252,750 NS A/G F/L rs886202 (DbSNP)
11 124,252,892 124,252,892 SYN A/G T/T rs644147 (DbSNP)
11 124,252,898 124,252,898 NS C/T M/I rs73612854 (DbSNP)
11 124,252,904 124,252,904 SYN G/A C/C rs3017589 (DbSNP)
11 124,252,919 124,252,919 SYN A/G F/F rs2320234 (DbSNP)
11 124,252,941 124,252,941 NS C/T R/Q rs71491823 (DbSNP)
11 124,252,960 124,252,960 NS A/T Y/N rs71491824 (DbSNP)
11 124,252,963 124,252,963 NS A/T S/T rs73025504 (DbSNP)
11 124,252,982 124,252,982 SYN C/T V/V rs71491825 (DbSNP)
11 124,253,100 124,253,100 NS A/G I/T rs71491826 (DbSNP)
11 124,253,140 124,253,140 NS C/T V/I rs61911135 (DbSNP)
11 124,253,147 124,253,147 SYN A/G F/F rs530704 (DbSNP)
11 124,253,161 124,253,161 NS A/G F/L rs530740 (DbSNP)
11 124,253,170 124,253,170 NS A/G W/R rs530765 (DbSNP)
11 124,253,181 124,253,181 NS C/T R/H rs28373946 (DbSNP)
11 124,382,996 124,382,996 SYN A/G T/T 1000GP (CEU)
11 124,383,035 124,383,035 SYN G/A F/F 1000GP (CHBJPT)
11 124,383,067 124,383,067 NS A/T S/T 1000GP (CEU)
11 124,383,251 124,383,251 SYN A/G F/F 1000GP (CEU, CHBJPT)
11 124,383,265 124,383,265 NS G/A L/F 1000GP (CEU, CHBJPT)
11 124,383,274 124,383,274 NS G/A R/W 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S93T T47I M39T L27F R24W H20R % Freq CORP
1 S T M L R H 46.01 0.846
2 S T M L R R 26.50 0.846
3 S T M F W R 18.51 0.846
4 S I M F W R 3.53 0.846
5 S I T L R R 1.92 0.846
6 S I M L R R 1.77 0.846
7 S T M L W R 1.15 0.846
8 T T M F W R 0.31 0.846
9 T T M L R R 0.08 0.846
10 S T T L R R 0.08 0.846
11 T I M F W R 0.08 0.846
12 S I M L W R 0.08 0.846

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8B3andOR8B2.aApr07 main_exon 3UTR chr11 124,382,402 124,382,405 -
CDS chr11 124,382,405 124,383,343 -
5UTR chr11 124,383,343 124,383,360 -
exon_5UTR chr11 124,384,374 124,384,503 -
exon_5UTR chr11 124,397,235 124,397,368 -
exon_5UTR chr11 124,398,690 124,398,748 -
exon_5UTR chr11 124,399,609 124,399,712 -
exon_5UTR chr11 124,405,871 124,406,002 -
exon_5UTR chr11 124,406,614 124,406,750 -
exon_5UTR chr11 124,409,650 124,409,683 -