Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8B3 Olfactory Receptor

Gene Symbol OR8B31 (View this gene in GeneCards)
Family 8
Subfamily B
Pseudogene No
CORP pseudogene probability score
Aliases AC002556-B, OR11-311, HsOR11.18.34, ORL345
External Ids HGNC: 8472   GeneBank: AB065827, AB065830, BK004204, NM_001005467   ORDB: ORL345   
Build #39 labels OR8B3
Chromosomal location 11:124,396,413-124,397,351 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B2 97.76% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8B3FP 85% 294
Chimp OR8B2 96% 313
Mouse Or8b3 83% 313
Mouse Or8b3b 81% 310
Rat Or8b3 84% 313
Rat Or8b3c 84% 313
Cow OR8B3G 86% 310
Orang OR8B2 95% 313
Horse OR8B3H 89% 314

Expression evidences

Source Accession
ESTs DN914774

Sequence information

Nucleotide sequence ATGCTGGCTAGAAACAACTCCTTAGTGACTGAATTTATTCTTGCTGGATTAACAGATCAT
CCAGAGTTCCAGCAACCCCTCTTTTTCCTGTTTCTAGTGGTCTACATTGTCACCATGGTA
GGCAACCTTGGCTTGATCATTCTTTTCGGTCTAAATTCTCACCTCCACACACCAATGTAC
TATTTCCTCTTCAATCTCTCCTTCATTGATCTCTGTTACTCCTCTGTTTTCACTCCCAAA
ATGCTAATGAACTTTGTATCAAAAAAGAATATTATCTCCTATGTTGGGTGCATGACTCAG
CTGTTTTTCTTTCTCTTTTTTGTCATCTCTGAATGTTACATGTTGACCTCAATGGCATAT
GATCGCTATGTGGCCATCTGTAATCCATTGCTGTATAAGGTCACCATGTCCCATCAGGTC
TGTTCTATGCTCACTTTTGCTGCTTACATAATGGGATTGGCTGGAGCCACGGCCCACACC
GGGTGCATGCTTAGACTCACCTTCTGCAGTGCTAATATCATCAACCATTACTTGTGTGAC
ATACTCCCCCTCCTCCAGCTTTCCTGCACCAGCACCTATGTCAACGAGGTGGTTGTTCTC
ATTGTTGTGGGTATTAATATCATGGTACCCAGTTGTACCATCCTCATTTCTTATGTTTTC
ATTGTCACTAGCATTCTTCATATCAAATCCACTCAAGGAAGATCAAAAGCCTTCAGTACT
TGTAGCTCTCATGTCATTGCTCTGTCTCTGTTTTTTGGGTCAGCGGCATTCATGTATATT
AAATATTCTTCTGGATCTATGGAGCAGGGAAAAGTTTCTTCTGTTTTCTACACTAATGTG
GTGCCCATGCTCAATCCTCTCATCTACAGTTTGAGGAACAAGGATGTCAAAGTTGCACTG
AGGAAAGCTCTGATTAAAATTCAGAGAAGAAATATATTC
Conceptual translation MLARNNSLVTEFILAGLTDHPEFQQPLFFLFLVVYIVTMVGNLGLIILFGLNSHLHTPMY
YFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISYVGCMTQLFFFLFFVISECYMLTSMAY
DRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCD
ILPLLQLSCTSTYVNEVVVLIVVGINIMVPSCTILISYVFIVTSILHIKSTQGRSKAFST
CSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVAL
RKALIKIQRRNIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T M/I 1000GP (YRI)
11 100 -100 SYN A/G C/C 1000GP (YRI)
11 124,266,390 124,266,390 SYN A/G P/P rs28496031 (DbSNP)
11 124,266,906 124,266,906 NS T/C I/M rs530992 (DbSNP)
11 124,266,912 124,266,912 SYN A/G C/C rs28398895 (DbSNP)
11 124,266,990 124,266,990 SYN C/T V/V rs4287348 (DbSNP)
11 124,267,177 124,267,177 NS C/T R/Q rs61910862 (DbSNP)
11 124,267,189 124,267,189 NS T/C H/R rs507335 (DbSNP)
11 124,397,010 124,397,010 NS C/T M/I 1000GP (CEU, CHBJPT)
11 124,397,016 124,397,016 SYN A/G C/C 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 54 (Hasin)
11 124,253,480 124,270,036 CopyNumber Variation_22874 (DGV)
11 124,253,880 124,269,631 CopyNumber Variation_101365 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C212F V34I Q24R H20R % Freq CORP
1 C V R R 59.45 0.441
2 C I R R 23.96 0.441
3 C V Q H 14.21 0.441
4 F I R R 1.77 0.441
5 C V Q R 0.23 0.441
6 C I Q H 0.23 0.441
7 C V R H 0.15 0.441

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8B3andOR8B2.bApr07-unspliced main_exon 3UTR chr11 124,396,410 124,396,413 -
CDS chr11 124,396,413 124,397,351 -