Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8B4 Olfactory Receptor

Gene Symbol OR8B41 (View this gene in GeneCards)
Family 8
Subfamily B
Pseudogene No
CORP pseudogene probability score
Aliases OR11-315, AC002556-D, HsOR11.18.35, ORL3423
External Ids HGNC: 8473   GeneBank: AB065831, AF399509, BK004205, NM_001005196   ORDB: ORL3423   
Build #39 labels OR8B4
Chromosomal location 11:124,423,945-124,424,871 (-)
Cluster 11@124
Synteny CLIC#29
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs4057749)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B1P 72.19% 302
OR8B3 68.18% 308
OR8C1P 67.21% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8B4 88% 308
Chimp CONTIG497.53-20652 95% 309
Mouse Or8b4 86% 309
Rat Or8b4 84% 309
Cow OR8B4 84% 309

Expression evidences

Source Accession
mRNA BC136865
GNF Atlas2 gnf1h11319_at

Sequence information

Nucleotide sequence ATGACTCTGAGAAACAGCTCCTCAGTGACTGAGTTTATCCTTGTGGGATTATCAGAACAG
CCAGAGCTCCAGCTCCCTCTTTTCCTTCTATTCTTAGGGATCTATGTGTTCACTGTGGTG
GGCAACTTGGGCTTGATCACCTTAATTGGGATAAATCCTAGCCTTCACACCCCCATGTAC
TTTTTCCTCTTCAACTTGTCCTTTATAGATCTCTGTTATTCCTGTGTGTTTACCCCCAAA
ATGCTGAATGACTTTGTTTCAGAAAGTATCATCTCTTATGTGGGATGTATGACTCAGCTA
TTTTTCTTCTGTTTCTTTGTCAATTCTGAGTGCTATGTGTTGGTATCAATGGCCTATGAT
CGCTATGTGGCCATCTGCAACCCCCTGCTCTACATGGTCACCATGTCCCCAAGGGTCTGC
TTTCTGCTGATGTTTGGTTCCTATGTGGTAGGGTTTGCTGGGGCCATGGCCCACACTGGA
AGCATGCTGCGACTGACCTTCTGTGATTCCAACGTCATTGACCATTATCTGTGTGACGTT
CTCCCCCTCTTGCAGCTCTCCTGCACCAGCACCCATGTCAGTGAGCTGGTATTTTTCATT
GTTGTTGGAGTAATCACCATGCTATCCAGCATAAGCATCGTCATCTCTTACGCTTTGATA
CTCTCCAACATCCTCTGTATTCCTTCTGCAGAGGGCAGATCCAAAGCCTTTAGCACATGG
GGCTCCCACATAATTGCTGTTGCTCTGTTTTTTGGGTCAGGGACATTCACCTACTTAACA
ACATCTTTTCCTGGCTCTATGAACCATGGCAGATTTGCCTCAGTCTTTTACACCAATGTG
GTTCCCATGCTTAACCCTTCGATCTACAGTTTGAGGAATAAGGATGATAAACTTGCCCTG
GGCAAAACCCTGAAGAGAGTGCTCTTC
Conceptual translation MTLRNSSSVTEFILVGLSEQPELQLPLFLLFLGIYVFTVVGNLGLITLIGINPSLHTPMY
FFLFNLSFIDLCYSCVFTPKMLNDFVSESIISYVGCMTQLFFFCFFVNSECYVLVSMAYD
RYVAICNPLLYMVTMSPRVCFLLMFGSYVVGFAGAMAHTGSMLRLTFCDSNVIDHYLCDV
LPLLQLSCTSTHVSELVFFIVVGVITMLSSISIVISYALILSNILCIPSAEGRSKAFSTW
GSHIIAVALFFGSGTFTYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLAL
GKTLKRVLF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G C/R 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN A/C V/V 1000GP (YRI)
11 124,294,213 124,294,213 NS C/A Q/H rs61736181 (DbSNP)
11 124,294,231 124,294,231 NS C/G E/D rs61736191 (DbSNP)
11 124,294,236 124,294,236 NS A/G C/R rs4057749 (DbSNP)
11 124,294,327 124,294,326 Ins(1) -/G rs36005108 (DbSNP)
11 124,294,349 124,294,349 NS A/C F/C rs7116575 (DbSNP)
11 124,294,377 124,294,377 NS A/G Y/H rs4057750 (DbSNP)
11 124,294,703 124,294,703 NS C/T G/E rs10750270 (DbSNP)
11 124,424,340 124,424,340 NS A/G C/R 1000GP (CEU, CHBJPT)
11 124,424,353 124,424,353 NS A/C I/M 1000GP (CHBJPT)
11 124,424,453 124,424,453 NS C/A C/F 1000GP (CEU, CHBJPT)
11 124,424,481 124,424,481 NS A/G Y/H 1000GP (CEU, CHBJPT)
11 124,424,807 124,424,807 NS T/C E/G 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L304R A248V Q185H C178R I173M C140F Y131H E22G % Freq CORP
1 L A Q C I C Y G 36.48 0.334
2 L A Q C I C Y E 33.64 0.334
3 L A Q R I F H E 16.67 1.000
4 L A Q R I C H E 9.45 1.000
5 L A Q R I C Y E 2.15 0.680
6 L A H C I C Y E 1.00 0.334
7 R A Q C I C Y G 0.23 0.334
8 L A Q R M F H E 0.15 1.000
9 L A H C I C Y G 0.08 0.334
10 L V Q C I C Y E 0.08 0.334
11 L A Q R I F H G 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8B4.aApr07-unspliced main_exon 3UTR chr11 124,423,942 124,423,945 -
CDS chr11 124,423,945 124,424,871 -