Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8D1 Olfactory Receptor

Gene Symbol OR8D11 (View this gene in GeneCards)
Family 8
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases JCG9, OST004, pDJ9j14, OR11-301, HsOR11.18.26, ORL3317
External Ids HGNC: 8481   GeneBank: AB065828, AF238489, BK004501, NM_001002917   ORDB: ORL3317   
Build #39 labels OR8D1
Chromosomal location 11:124,309,843-124,310,766 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8D2 70.13% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8D2 73% 308
Chimp CONTIG96538.1-345 99% 265
Mouse Or8d1b 85% 308
Mouse Or8d1 85% 308
Rat Or8d1g-ps 82% 308
Rat Or8d1f-ps 82% 308
Rat Or8d1e-ps 82% 308
Rat Or8d1d-ps 82% 308
Cow OR8D2P 74% 308

Expression evidences

Source Accession
mRNA AF238489

Sequence information

Nucleotide sequence ATGACCATGGAAAATTATTCTATGGCAGCTCAGTTTGTCTTAGATGGTTTAACACAGCAA
GCAGAGCTCCAGCTGCCCCTCTTCCTCCTGTTCCTGGGAATCTATGTGGTCACAGTAGTG
GGCAACCTGGGCATGATTCTCCTGATTGCAGTCAGCCCTCTACTTCACACCCCCATGTAC
TATTTCCTCAGCAGCTTGTCCTTCGTCGATTTCTGCTATTCCTCTGTCATTACTCCCAAA
ATGCTGGTGAACTTCCTAGGAAAGAAGAATACAATCCTTTACTCTGAGTGCATGGTCCAG
CTCTTTTTCTTTGTGGTCTTTGTGGTGGCTGAGGGTTACCTCCTGACTGCCATGGCATAT
GATCGCTATGTTGCCATCTGTAGCCCACTGCTTTATAATGCGATCATGTCCTCATGGGTC
TGCTCACTGCTAGTGCTGGCTGCCTTCTTCTTGGGCTTTCTCTCTGCCTTGACTCATACA
AGTGCCATGATGAAACTGTCCTTTTGCAAATCCCACATTATCAACCATTACTTCTGTGAT
GTTCTTCCCCTCCTCAATCTCTCCTGCTCCAACACACACCTCAATGAGCTTCTACTTTTT
ATCATTGCGGGGTTTAACACCTTGGTGCCCACCCTAGCTGTTGCTGTCTCCTATGCCTTC
ATCCTCTACAGCATCCTTCACATCCGCTCCTCAGAGGGCCGGTCCAAAGCTTTTGGAACA
TGCAGCTCTCATCTCATGGCTGTGGTGATCTTCTTTGGGTCCATTACCTTCATGTATTTC
AAGCCCCCTTCAAGTAACTCCCTGGACCAGGAGAAGGTGTCCTCTGTGTTCTACACCACG
GTGATCCCCATGCTGAACCCTTTAATATACAGTCTGAGGAATAAGGATGTGAAGAAAGCA
TTAAGGAAGGTCTTAGTAGGAAAA
Conceptual translation MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY
YFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY
DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD
VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT
CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
LRKVLVGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A S/F 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T V/V 1000GP (YRI)
11 124,179,835 124,179,835 SYN C/T V/V rs4936918 (DbSNP)
11 124,179,902 124,179,902 NS A/G F/S rs57552127 (DbSNP)
11 124,180,063 124,180,063 Del(1) -/A rs34197526 (DbSNP)
11 124,180,082 124,180,082 NS A/G L/P rs4936919 (DbSNP)
11 124,180,173 124,180,172 Ins(1) -/T rs36031700 (DbSNP)
11 124,180,282 124,180,282 NS A/C C/W rs7107539 (DbSNP)
11 124,180,359 124,180,359 NS C/A V/F rs2510433 (DbSNP)
11 124,180,477 124,180,477 SYN A/G F/F rs6590057 (DbSNP)
11 124,309,939 124,309,939 SYN C/T V/V 1000GP (CEU, CHBJPT)
11 124,310,006 124,310,006 NS G/A S/F 1000GP (CHBJPT)
11 124,310,186 124,310,186 NS A/G L/P 1000GP (CEU, CHBJPT)
11 124,310,386 124,310,386 NS A/C C/W 1000GP (CEU, CHBJPT)
11 124,310,581 124,310,581 SYN G/A F/F 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S254F I201T L194P C127W F102V % Freq CORP
1 S I L C F 54.84 0.199
2 S I P W F 29.95 0.199
3 F I L C F 11.29 0.199
4 S I P C F 1.84 0.199
5 S T L C F 1.23 0.199
6 S I L C V 0.77 0.199
7 S I P W V 0.08 0.199

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8D1.aApr07-unspliced main_exon 3UTR chr11 124,309,840 124,309,843 -
CDS chr11 124,309,843 124,310,766 -