Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8D4 Olfactory Receptor

Gene Symbol OR8D41 (View this gene in GeneCards)
Family 8
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.16 (functional)
Aliases OR11-275, HsOR11.18.5, ORL3289
External Ids HGNC: 14840   GeneBank: AB065761, BK004313, NM_001005197   ORDB: ORL3289   
Build #39 labels OR8D4
Chromosomal location 11:123,906,432-123,907,373 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8A1 65.05% 309
OR8D1 65.25% 305
60.45% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8D4 83% 311
Chimp CONTIG708.113-18098 97% 314
Mouse Or8d4 85% 310
Rat Or8d4 85% 310
Cow OR8D4 86% 310

Expression evidences

Source Accession
ESTs AL706931
mRNA BC137206
GNF Atlas2 gnf1h05555_at
GNF Atlas2 gnf1h05556_s_at

Sequence information

Nucleotide sequence ATGGGTGTAAAAAACCATTCCACAGTGACTGAGTTTCTTCTTTCAGGATTAACTGAACAA
GCAGAGCTTCAGCTGCCCCTCTTCTGCCTCTTCTTAGGAATTTACACAGTTACTGTGGTG
GGAAACCTCAGCATGATCTCAATTATTAGGCTGAATCGTCAACTTCATACCCCCATGTAC
TATTTCCTGAGTAGTTTGTCTTTTTTAGATTTCTGCTATTCTTCTGTCATTACCCCTAAA
ATGCTATCAGGGTTTTTATGCAGAGATAGATCCATCTCCTATTCTGGATGCATGATTCAG
CTGTTTTTTTTCTGTGTTTGTGTTATTTCTGAATGCTACATGCTGGCAGCCATGGCCTGC
GATCGCTACGTGGCCATCTGCAGCCCACTGCTCTACAGGGTCATCATGTCCCCTAGGGTC
TGTTCTCTGCTGGTGGCTGCTGTCTTCTCAGTAGGTTTCACTGATGCTGTGATCCATGGA
GGTTGTATACTCAGGTTGTCTTTCTGTGGATCAAACATCATTAAACATTATTTCTGTGAC
ATTGTCCCTCTTATTAAACTCTCCTGCTCCAGCACTTATATTGATGAGCTTTTGATTTTT
GTCATTGGTGGATTTAACATGGTGGCCACAAGCCTAACAATCATTATTTCATATGCTTTT
ATCCTCACCAGCATCCTGCGCATCCACTCTAAAAAGGGCAGGTGCAAAGCGTTTAGCACC
TGTAGCTCCCACCTGACAGCTGTTCTTATGTTTTATGGGTCTCTGATGTCCATGTATCTC
AAACCTGCTTCTAGCAGTTCACTCACCCAGGAGAAAGTATCCTCAGTATTTTATACCACT
GTGATTCTCATGTTGAATCCCTTGATATATAGTCTGAGGAACAATGAAGTAAGAAATGCT
CTGATGAAACTTTTAAGAAGAAAAATATCTTTATCTCCAGGA
Conceptual translation MGVKNHSTVTEFLLSGLTEQAELQLPLFCLFLGIYTVTVVGNLSMISIIRLNRQLHTPMY
YFLSSLSFLDFCYSSVITPKMLSGFLCRDRSISYSGCMIQLFFFCVCVISECYMLAAMAC
DRYVAICSPLLYRVIMSPRVCSLLVAAVFSVGFTDAVIHGGCILRLSFCGSNIIKHYFCD
IVPLIKLSCSSTYIDELLIFVIGGFNMVATSLTIIISYAFILTSILRIHSKKGRCKAFST
CSSHLTAVLMFYGSLMSMYLKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNA
LMKLLRRKISLSPG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/G L/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C C/C 1000GP (YRI)
11 123,777,268 123,777,268 NS A/C S/R rs61734934 (DbSNP)
11 123,777,289 123,777,289 SYN C/T L/L rs57888441 (DbSNP)
11 123,777,302 123,777,302 NS G/T R/L rs17127947 (DbSNP)
11 123,777,412 123,777,412 NS A/G I/V rs17127950 (DbSNP)
11 123,777,497 123,777,497 NS A/G Y/C rs10750250 (DbSNP)
11 123,777,498 123,777,498 SYN C/T C/C rs10893102 (DbSNP)
11 123,777,502 123,777,502 NS C/T R/C rs61907183 (DbSNP)
11 123,777,511 123,777,511 NS G/T A/S rs61745074 (DbSNP)
11 123,777,536 123,777,536 NS A/G K/R rs7926767 (DbSNP)
11 123,777,736 123,777,736 NS C/T L/F rs10790610 (DbSNP)
11 123,777,752 123,777,752 NS C/T S/F rs12270203 (DbSNP)
11 123,777,754 123,777,753 Ins(1) -/C rs35139196 (DbSNP)
11 123,777,754 123,777,754 NS A/C N/H rs61744420 (DbSNP)
11 123,777,861 123,777,861 SYN C/T C/C rs61748875 (DbSNP)
11 123,777,986 123,777,986 NS C/T P/L rs7942047 (DbSNP)
11 123,778,031 123,778,031 NS A/G K/R rs7927385 (DbSNP)
11 123,906,595 123,906,595 NS T/G L/R 1000GP (CEU, CHBJPT)
11 123,906,705 123,906,705 NS A/G I/V 1000GP (CEU, CHBJPT)
11 123,906,790 123,906,790 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 123,906,791 123,906,791 SYN C/T C/C 1000GP (CEU, CHBJPT)
11 123,906,795 123,906,795 NS C/T R/C 1000GP (CEU)
11 123,906,829 123,906,829 NS G/A R/K 1000GP (CEU, CHBJPT)
11 123,906,839 123,906,839 NS G/C M/I 1000GP (CEU)
11 123,907,029 123,907,029 NS T/C F/L 1000GP (CEU, CHBJPT)
11 123,907,154 123,907,154 SYN T/C C/C 1000GP (CEU, CHBJPT)
11 123,907,279 123,907,279 NS T/C L/P 1000GP (CEU, CHBJPT)
11 123,907,324 123,907,324 NS G/A R/K 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T38S S44R I48V L55R I92V A125S R133K M136I F200L N206H S239N L283P R298K % Freq CORP
1 T S I L I A K M L N S P K 25.12 0.300
2 T S I L I A K M F N S P K 22.20 0.300
3 T S I R V A K M F N S P K 17.67 0.792
4 T S I L I A R M F N S L R 15.90 0.446
5 T S I L I A R M F N S P R 13.29 0.300
6 T S I R V A K M F N N P K 2.15 0.857
7 T S I L I S K M F N S P K 1.84 1.000
8 T S V L I A R M F N S P R 0.31 0.300
9 T S I L I A K M F N S P R 0.31 0.300
10 T R I L I A K M F H S P K 0.31 0.300
11 T S I L I A R M F N S P K 0.23 0.300
12 T S I L I A R M L N S P K 0.08 0.300
13 T S I L I A K M L N S L K 0.08 0.446
14 T S I L I A K I L N S P K 0.08 0.377
15 T S I R V A R M F N S P K 0.08 0.792
16 T S I L V A R M F N S L R 0.08 0.573
17 T S I R V A K M F N S P R 0.08 0.792
18 S S I L I A K M L N S P K 0.08 0.300
19 T S I L I A R M F N S L K 0.08 0.446
20 T S I L I A K M L N N P K 0.08 0.403

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8D4.aApr07-unspliced main_exon 5UTR chr11 123,906,146 123,906,432 +
CDS chr11 123,906,432 123,907,373 +
3UTR chr11 123,907,373 123,907,376 +