Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8G3P Olfactory Receptor

Gene Symbol OR8G3P1 (View this gene in GeneCards)
Family 8
Subfamily G
Pseudogene Yes
CORP pseudogene probability score 0.96 (pseudogene)
Aliases OR11-288, OR11-297, HsOR11.18.21P, ORL3434
External Ids HGNC: 14698   GeneBank: AB065947, BK004424, BK004636, NG_004312   ORDB: ORL3434   
Build #39 labels OR8G3P
Chromosomal location 11:124,214,749-124,215,684 (+)
Cluster 11@124
Synteny CLIC#29
Remarks Full ORF without a suitable ATG

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8G2P 91.86% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8G3 83% 310
Chimp CONTIG497.27-19525 93% 310
Mouse Or8g2 83% 304
Rat Or8g2 80% 309
Cow OR8G3 80% 312
Cow OR8G3D 85% 303
Cow OR8G3E 83% 303
Cow OR8G3C 82% 302
Cow OR8G3F 83% 305

Expression evidences

Source Accession
ESTs BX280907

Sequence information

Nucleotide sequence AAGATCGTGGACCCTGGAAACCATTCCTCAGTGACTGAGTCCATTCTGGCTGGGCTCTCA
GAACAGCCAGAGCTCCAGCTGCGCCTCTTCCTCCTGTTCTTAGGAATCTGTGTGGTCACA
GTGGTGGGCAACTTGGGCATGATCACACTGATTGGGCTCAGTTCTCACCTGCACACACCT
ATGTACTATTTCCTCAGCAGTCTGTCCTTCATTGACTTCTGCCATTCCACTGTCATTACC
CCTAAGATGCTGGTGAACTTTGCGACAGAGAAGAACATCATCTCCTACCCTGAATGCATG
GCTCAGCTCTATTTATTCAGTATTTTTGCTATTGCAGAGTGTCACATGTTGGCTGCAATG
GCGTATGACTGTTATGTTGCCATCTGCAGCCCCTTGCTGTACAATGTCATCATGTCCTAT
CACCACTGCTTCTGGCTCACAGTGGGAGTTTACATTTTAGGCATCCTTGGATCTACAATT
CATACCAGTTTTATGTTGAGACTCTTTTTGTGCAAGACTAATGTGATTAACCATTATTTT
TGTGATCTTTTCCCTCTCTTGGGGCTCTCCTGCTCCAGCACCTACATCAATGAATTACTG
GTTCTGGTCTTGAGTGCATTTAACATCCTGATGCCTGCCTTAACCATCCTTGCTTCTTAC
ATCTTTATCATTGCCAGCATCCTCCGCATTCACTCCACTGAGGGCAGGTCCAAAGCCTTT
AGCACTTGCAGCTCCCACATCTTGGCTGTTGCTGTTTTCTTTGGATCTGCAGCATTCATG
TACCTGCAGCCATCATCTGTCAGCTCCATGGACCAGAGGAAAGTGTCGTCTGTGTTTTAT
ACTACTATTGTGCCCATGCTGAACCCCCTGATCTACAGCCTGAGGAATAAAGATGTCAAA
CTTGCCGTGAAGAAAATTCTGCATCAGACAGCATGT
Conceptual translation KIVDPGNHSSVTESILAGLSEQPELQLRLFLLFLGICVVTVVGNLGMITLIGLSSHLHTP
MYYFLSSLSFIDFCHSTVITPKMLVNFATEKNIISYPECMAQLYLFSIFAIAECHMLAAM
AYDCYVAICSPLLYNVIMSYHHCFWLTVGVYILGILGSTIHTSFMLRLFLCKTNVINHYF
CDLFPLLGLSCSSTYINELLVLVLSAFNILMPALTILASYIFIIASILRIHSTEGRSKAF
STCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNPLIYSLRNKDVK
LAVKKILHQTAC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 124,085,462 124,085,462 SNP A/G rs948071 (DbSNP)
11 124,085,672 124,085,672 SNP T/G rs73017549 (DbSNP)
11 124,085,880 124,085,880 SNP G/A rs2466727 (DbSNP)
11 124,086,004 124,086,004 SNP C/T rs56941021 (DbSNP)
11 124,086,087 124,086,087 SNP C/T rs59923179 (DbSNP)
11 124,086,175 124,086,175 SNP C/T rs2508890 (DbSNP)
11 124,214,755 124,214,755 SNP G/A 1000GP (CEU, CHBJPT)
11 124,215,468 124,215,468 SNP T/C 1000GP (CHBJPT)
11 124,215,655 124,215,655 SNP G/A 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 104 (Hasin)
11 124,084,883 124,086,991 CopyNumber Variation_34920 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8G3P.aApr07-unspliced main_exon CDS_partial chr11 124,215,133 124,215,684 +
3UTR chr11 124,215,684 124,215,908 +