Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8G5 Olfactory Receptor

Gene Symbol OR8G51 (View this gene in GeneCards)
Family 8
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.68 (pseudogene)
Aliases OR11-298, HsOR11.18.25
External Ids HGNC: 19622   GeneBank: AB065958, BK004516, NM_001005198   
Build #39 labels OR8G5P, OR8G6
Chromosomal location 11:124,264,932-124,265,864 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
84.57% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8G5 81% 311
Chimp CONTIG*********** 97% 311
Mouse Or8f1 78% 307
Rat Or8g20 78% 311
Cow OR8G5 80% 311
Cow OR8G5B 81% 311

Expression evidences

Source Accession
mRNA BC136822

Sequence information

Nucleotide sequence ATGGCAGCAGAAAACCATTCTTTTGTGACTAAGTTTATTCTGGTTGGGCTAACAGAGAAG
TCAGAGCTACAGCTGCCCCTCTTCCTCGTCTTCCTGGGAATCTATGTAGTCACAGTGCTG
GGGAACCTGGGCATGATCACACTGATTGGGCTCAGTTCTCACCTGCACACACCTATGTAC
TGTTTCCTCAGCAGTCTGTCCTTCATTGACTTCTGCCATTCCACTGTCATTACCCCTAAG
ATGCTGGTGAACTTTGTGACAGAGAAGAACATCATCTCCTACCCTGAATGCATGACTCAG
CTCTACTTCTTCCTCGTTTTTGCTATTGCAGAGTGTCACATGTTGGCTGCAATGGCATAT
GACGGCTACGTGGCCATCTGTAGCCCCTTGCTGTACAGCATCATCATATCCAATAAGGCT
TGCTTTTCTCTGATTTTAGTGGTGTATGTAATAGGCCTGATTTGTGCGTCAGCTCATATA
GGCTGTATGTTTAGGGTTCAATTCTGCAAATTTGATGTGATCAACCATTATTTCTGTGAT
CTTATTTCTATCTTGAAGCTCTCCTGTTCTAGTACTTACATTAATGAGTTACTGATTTTA
ATCTTTAGTGGAATTAACATCCTTGTCCCCAGCCTGACCATCCTCAGCTCTTACATCTTC
ATCATTGCCAGCATCCTCCGCATTCGCTACACTGAGGGCAGGTCCAAAGCCTTCAGCACT
TGCAGCTCCCACATCTCGGCTGTTTCTGTTTTCTTTGGGTCTGCAGCATTCATGTACCTG
CAGCCATCATCTGTCAGCTCCATGGACCAGGGGAAAGTGTCCTCTGTGTTTTATACTATT
GTTGTGCCCATGCTGAACCCCCTGATCTACAGCCTGAGGAATAAAGATGTCCACGTTGCC
CTGAAGAAAACGCTAGGGAAAAGAACATTCTTA
Conceptual translation MAAENHSFVTKFILVGLTEKSELQLPLFLVFLGIYVVTVLGNLGMITLIGLSSHLHTPMY
CFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY
DGYVAICSPLLYSIIISNKACFSLILVVYVIGLICASAHIGCMFRVQFCKFDVINHYFCD
LISILKLSCSSTYINELLILIFSGINILVPSLTILSSYIFIIASILRIRYTEGRSKAFST
CSSHISAVSVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVHVA
LKKTLGKRTFL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A G/E 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T Y/Y 1000GP (YRI)
11 124,134,925 124,134,925 NS A/G E/G rs62622834 (DbSNP)
11 124,135,009 124,135,009 NS G/A C/Y rs2512168 (DbSNP)
11 124,135,140 124,135,140 NS C/T L/F rs62622835 (DbSNP)
11 124,135,215 124,135,215 NS G/T V/L rs11219544 (DbSNP)
11 124,135,438 124,135,438 NS G/A G/E rs2512167 (DbSNP)
11 124,135,481 124,135,481 SYN T/C Y/Y rs2466701 (DbSNP)
11 124,135,662 124,135,662 NS G/A A/T rs2512166 (DbSNP)
11 124,135,677 124,135,677 NS A/G M/V rs10893192 (DbSNP)
11 124,265,113 124,265,113 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 124,265,319 124,265,319 NS T/G L/V 1000GP (CEU)
11 124,265,542 124,265,542 NS G/A G/E 1000GP (CEU, CHBJPT)
11 124,265,585 124,265,585 SYN C/T Y/Y 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G33E I49T H56Y L105F L130V A156V G204E Y230S T279A M284V A300S % Freq CORP
1 G I H L L A G Y T M A 42.70 0.915
2 G I H L L A E Y T M A 33.49 0.915
3 G I H L L A E Y A M A 10.60 0.915
4 G I H L V A G Y T V A 5.99 0.516
5 G I Y L L A E Y T M A 3.07 0.915
6 E I H L L A G Y T M A 1.92 0.915
7 G I H L L A E S T M A 0.69 0.915
8 G I H F L A G Y T M A 0.38 0.915
9 G I H L L A E Y T M S 0.38 0.915
10 G I H L L A G Y T V A 0.31 0.915
11 G I H L V A G Y T M A 0.15 0.516
12 G I H F L A E Y T M A 0.08 0.915
13 G T H L L A E Y T M A 0.08 0.915
14 G I H L L V E Y T M A 0.08 0.915
15 E I H L L A G Y T V A 0.08 0.915

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8G5.aApr07-unspliced main_exon 5UTR chr11 124,264,827 124,264,932 +
CDS chr11 124,264,932 124,265,864 +
3UTR chr11 124,265,864 124,265,867 +