Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8H1 Olfactory Receptor

Gene Symbol OR8H11 (View this gene in GeneCards)
Family 8
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-180, HsOR11.11.57, ORL3416
External Ids HGNC: 14824   GeneBank: AB065836, BK004337, NM_001005199   ORDB: ORL3416   
Build #39 labels OR8H1
Chromosomal location 11:56,290,130-56,291,062 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8H2 87.46% 311
OR8H3 89.07% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8H4 80% 311
Chimp CONTIG*********** 97% 311
Mouse Or8h9 74% 309
Rat Or8h10 74% 312
Cow OR8H4P 75% 312

Expression evidences

Source Accession
mRNA BC136910

Sequence information

Nucleotide sequence ATGGGTAGAAGAAATAACACAAATGTGCCTGACTTCATCCTTACGGGACTGTCAGATTCT
GAAGAGGTCCAGATGGCCCTCTTTATACTATTTCTCCTGATATACCTAATTACTATGCTG
GGCAATGTGGGGATGATATTGATAATCCGCCTGGACCTCCAGCTTCACACTCCCATGTAT
TTTTTCCTTACTCACTTGTCATTTATTGACCTCAGTTACTCAACTGTCATCACACCTAAA
ACCTTAGCGAACTTACTGACTTCCAACTATATTTCCTTCATGGGCTGCTTTGCCCAGATG
TTCTTTTTTGTCTTCTTGGGAGCTGCTGAATGTTTTCTTCTCTCATCAATGGCCTATGAT
CGCTACGTAGCTATCTGCAGTCCTCTACGTTACCCAGTTATTATGTCCAAAAGGCTGTGT
TGCGCTCTTGTCACTGGGCCCTATGTGATTAGCTTTATCAACTCCTTTGTCAATGTGGTT
TGGATGAGCAGACTGCATTTCTGCGACTCAAATGTAGTTCGTCACTTTTTCTGCGACACG
TCTCCAATTTTAGCTCTGTCCTGCATGGACACATACGACATTGAAATCATGATACACATT
TTAGCTGGTTCCACCCTGATGGTGTCCCTTATCACAATATCTGCATCCTATGTGTCCATT
CTCTCTACCATCCTGAAAATTAATTCCACTTCAGGAAAGCAGAAAGCTTTGTCTACTTGT
GCCTCTCATCTCTTGGGAGTCACCATCTTTTATGGAACTATGATTTTTACTTATTTAAAA
CCAAGAAAGTCTTATTCTTTGGGAAGGGATCAAGTGGCTTCTGTTTTTTATACTATTGTG
ATTCCCATGCTGAATCCACTCATTTATAGTCTTAGAAACAAAGAAGTTAAAAATGCTCTC
ATTAGAGTCATGCAGAGAAGACAGGACTCCAGG
Conceptual translation MGRRNNTNVPDFILTGLSDSEEVQMALFILFLLIYLITMLGNVGMILIIRLDLQLHTPMY
FFLTHLSFIDLSYSTVITPKTLANLLTSNYISFMGCFAQMFFFVFLGAAECFLLSSMAYD
RYVAICSPLRYPVIMSKRLCCALVTGPYVISFINSFVNVVWMSRLHFCDSNVVRHFFCDT
SPILALSCMDTYDIEIMIHILAGSTLMVSLITISASYVSILSTILKINSTSGKQKALSTC
ASHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL
IRVMQRRQDSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A R/C 1000GP (YRI)
11 100 -100 SYN G/A L/L 1000GP (YRI)
11 56,057,898 56,057,898 NS A/G F/S rs61888286 (DbSNP)
11 56,058,197 56,058,197 SYN A/G L/L rs1842674 (DbSNP)
11 56,058,474 56,058,474 NS A/T V/E rs17540861 (DbSNP)
11 56,058,535 56,058,535 NS C/T G/S rs11600896 (DbSNP)
11 56,290,721 56,290,721 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 56,290,998 56,290,998 NS T/A E/V 1000GP (CEU)
11 56,291,059 56,291,059 NS C/T G/S 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 8 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S214F R130C L114F E22V G2S % Freq CORP
1 S R L E G 84.87 0.098
2 S R L E S 9.06 0.098
3 F R L V G 4.45 0.098
4 S C L E G 0.54 0.098
5 S R L V G 0.38 0.098
6 F R L E G 0.31 0.098
7 S R F E G 0.31 0.098
8 S R F V G 0.08 0.098

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8H1.aApr07-unspliced main_exon 3UTR chr11 56,290,127 56,290,130 -
CDS chr11 56,290,130 56,291,062 -