Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8H2 Olfactory Receptor

Gene Symbol OR8H21 (View this gene in GeneCards)
Family 8
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-171, HsOR11.11.46, ORL3407
External Ids HGNC: 15308   GeneBank: AB065657, AB065845, BK004341, NM_001005200   ORDB: ORL3407   
Build #39 labels OR8H2
Chromosomal location 11:56,105,043-56,105,978 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8H1 87.46% 311
OR8H3 91.99% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8H4 77% 311
Chimp CONTIG970.13-4997 93% 311
Chimp CONTIG970.14-11744 97% 297
Mouse Or8h6 71% 312
Rat Or8h10 72% 312
Cow OR8H4P 75% 312

Expression evidences

Source Accession
GNF Atlas2 gnf1h10664_at

Sequence information

Nucleotide sequence ATGATGGGTAGAAGGAATAACACAAATGTGGCTGACTTCATCCTTATGGGACTGACACTT
TCTGAAGAGATCCAGATGGCTCTGTTTATGCTATTTCTCCTGATATACCTAATTACTATG
CTGGGGAATGTGGGGATGATATTGATAATCCGCCTGGACCTCCAGCTTCACACTCCCATG
TATTTTTTCCTTACTCACCTGTCATTTATTGACCTCAGTTACTCAACTGTCGTCACACCT
AAAACCTTAGCGAACTTACTGACTTCCAACTATATTTCCTTTACGGGCTGCTTTGCCCAG
ATGTTCTTTTTTGCCTTCTTGGGTACTGCTGAATGTTACCTTCTCTCCTCAATGGCCCAT
GATCGCTATGCAGCGATCTGCAGTCCTCTACACTACACAGTTATTATGTCCAAAAGGCTC
TGCCTCGCTCTCATCACTGGGCCTTATGTGATTGGCTTTATAGACTCCTTTGTCAACGTG
GTTTCCATGAGCAGATTGCATTTCTACGACTCAAACGTAATTCATCACTTTTTCTGTGAC
ACTTCCCCAATTTTAGCTCTGTCCTGCACTGATACATACAACACCGAAATCCTGATATTC
ATTATTGTTGGTTCCACCCTGATGGTGTCCCTTTTCACAATATCTGCATCCTATGTGTTC
ATTCTCTTTACCATCCTGAAAATTAATTCCACTTCAGGAAAGCAGAAAGCTTTCTCTACT
TGCGTCTCTCATCTCTTGGGAGTCACCATCTTTTATAGCACTCTGATTTTTACTTATTTA
AAACCAAGAAAGTCTTATTCCTTGGGAAGAGATCAAGTGGCTTCTGTTTTTTATACTATT
GTGATTCCCGTGCTGAATCCACTCATTTATAGTCTTAGAAACAAAGAGGTGAAAAATGCT
GTCATCAGAGTCATGCAGAGAAGACAGGACTCCAGG
Conceptual translation MMGRRNNTNVADFILMGLTLSEEIQMALFMLFLLIYLITMLGNVGMILIIRLDLQLHTPM
YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFFFAFLGTAECYLLSSMAH
DRYAAICSPLHYTVIMSKRLCLALITGPYVIGFIDSFVNVVSMSRLHFYDSNVIHHFFCD
TSPILALSCTDTYNTEILIFIIVGSTLMVSLFTISASYVFILFTILKINSTSGKQKAFST
CVSHLLGVTIFYSTLIFTYLKPRKSYSLGRDQVASVFYTIVIPVLNPLIYSLRNKEVKNA
VIRVMQRRQDSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T R/S 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G Q/Q 1000GP (YRI)
11 55,872,537 55,872,537 NS A/G N/D rs61746549 (DbSNP)
11 55,872,620 55,872,620 SYN C/G L/L rs61745328 (DbSNP)
11 55,872,657 55,872,657 NS A/C I/L rs28681529 (DbSNP)
11 55,872,802 55,872,802 NS C/G T/R rs61750935 (DbSNP)
11 55,872,832 55,872,832 NS C/T A/V rs61750923 (DbSNP)
11 55,872,876 55,872,876 NS C/T H/Y rs2512961 (DbSNP)
11 55,872,980 55,872,980 NS A/G I/M rs61734406 (DbSNP)
11 55,872,990 55,872,990 NS C/G L/V rs61734403 (DbSNP)
11 55,873,013 55,873,013 NS A/T R/S rs61734399 (DbSNP)
11 55,873,024 55,873,024 NS A/G Y/C rs2449148 (DbSNP)
11 55,873,026 55,873,026 NS G/T D/Y rs61734396 (DbSNP)
11 55,873,095 55,873,095 NS G/T D/Y rs61745886 (DbSNP)
11 55,873,119 55,873,119 NS A/G I/V rs61734225 (DbSNP)
11 55,873,126 55,873,126 NS C/T A/V rs61734224 (DbSNP)
11 55,873,144 55,873,144 NS C/T A/V rs72919590 (DbSNP)
11 55,873,293 55,873,293 NS C/T H/Y rs61731255 (DbSNP)
11 55,873,334 55,873,334 SYN A/G Q/Q rs11227212 (DbSNP)
11 55,873,368 55,873,368 NS A/G M/V rs1842696 (DbSNP)
11 56,105,356 56,105,356 NS C/T A/V 1000GP (CEU)
11 56,105,504 56,105,504 NS A/G I/M 1000GP (CEU)
11 56,105,514 56,105,514 NS G/C V/L 1000GP (CEU)
11 56,105,548 56,105,548 NS A/G Y/C 1000GP (CEU, CHBJPT)
11 56,105,550 56,105,550 NS G/T D/Y 1000GP (CEU)
11 56,105,817 56,105,817 NS T/C Y/H 1000GP (CEU)
11 56,105,858 56,105,858 SYN A/G Q/Q 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 224 (Hasin)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I47L N90S T95R A105V H120Y I154M V158L R165S Y169C D170Y T206I V209A Y259H P262L V284M K295E % Freq CORP
1 I N T A Y I V R C D T V Y P M K 69.97 0.098
2 L N T A Y I V R C D T V Y P M K 17.97 0.098
3 I N T V H M L R C Y T V H P M K 3.61 0.098
4 I N T A Y I V S C D T V Y P M K 3.23 0.098
5 I N T A Y I V R C D T V Y P M E 1.08 0.098
6 I N T V H I V R C D T V H P M K 0.84 0.098
7 I N R A Y I V R C D T V Y P M K 0.61 0.098
8 L N T A Y I V R C D T A Y P M K 0.46 0.098
9 L N T A Y I V R C D T V Y L M K 0.38 0.098
10 I N T V H I V R C Y T V H P M K 0.31 0.098
11 I S T A Y I V R C D T V Y P M K 0.23 0.098
12 I N T V Y I V R C D T V Y P M K 0.15 0.098
13 L N T V Y I V R C D T V Y P M K 0.15 0.098
14 I N T A H I V R C D T V Y P M K 0.15 0.098
15 I N T A H I V R C D T V Y P V K 0.15 0.098
16 I N T A Y I V R C D T V Y P V K 0.08 0.098
17 I N T A Y I V R C D T V H P M K 0.08 0.098
18 I N T V H I L R C Y T V H P M K 0.08 0.098
19 I N T V H I L R C Y I V H P M K 0.08 0.098
20 L N T V H I V R C D T V Y P M K 0.08 0.098
21 L N T A Y I V R C D T V Y P V K 0.08 0.098
22 L N T A H I V R C D T V Y P M K 0.08 0.098
23 I N T V H I V R C Y I V H P M K 0.08 0.098
24 I N T V H I L R C Y T V Y P M K 0.08 0.098

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8H2.aApr07-unspliced main_exon CDS chr11 56,105,043 56,105,978 +
3UTR chr11 56,105,978 56,105,981 +