Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8H3 Olfactory Receptor

Gene Symbol OR8H31 (View this gene in GeneCards)
Family 8
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-172, HsOR11.11.47
External Ids HGNC: 15309   GeneBank: AB065658, AB065840, BK004345, NM_001005201   
Build #39 labels OR8H3
Chromosomal location 11:56,122,373-56,123,308 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8H1 89.07% 311
OR8H2 91.99% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8H4 77% 311
Chimp CONTIG970.13-4997 97% 311
Mouse Or8h9 72% 310
Rat Or8h10 73% 312
Cow OR8H4P 73% 312

Expression evidences

Source Accession
GNF Atlas2 gnf1h10665_at

Sequence information

Nucleotide sequence ATGATGGGTAGAAGGAATGACACAAATGTGGCTGACTTCATCCTTACGGGACTGTCAGAC
TCTGAAGAGGTCCAGATGGCTCTGTTTATGCTATTTCTCCTCATATACCTAATTACTATG
CTGGGGAATGTGGGGATGCTATTGATAATCCGCCTGGACCTCCAGCTTCACACTCCCATG
TATTTTTTCCTTACTCACCTGTCATTTATTGACCTCAGTTACTCAACTGTCGTCACACCT
AAAACCTTAGCGAACTTACTGACTTCCAACTATATTTCCTTCACGGGCTGCTTTGCCCAG
ATGTTCTGTTTTGTCTTCTTGGGTACTGCTGAATGTTATCTTCTCTCCTCAATGGCCTAT
GATCGCTATGCAGCGATCTGCAGTCCTCTACACTACACAGTTATTATGCCCAAAAGGCTC
TGCCTCGCTCTCATCACTGGGCCTTATGTGATTGGCTTTATGGACTCCTTTGTCAATGTG
GTTTCCATGAGCAGATTGCATTTCTGTGACTCAAACATAATTCATCACTTTTTCTGTGAC
ACTTCCCCAATTTTAGCTCTGTCCTGCACTGACACAGACAACACTGAAATGCTGATATTC
ATTATCGCTGGTTCCACCCTGATGGTGTCCCTTATCACAATATCTGCATCCTATGTGTCC
ATTCTCTCTACCATCCTGAAAATTAATTCCACTTCAGGAAAGCAGAAAGCTTTCTCTACT
TGCGTCTCTCATCTCTTGGGAGTCACCATCTTCTATGGAACTATGATTTTTACTTACTTA
AAGCCAAGAAAGTCTTATTCCTTGGGAAGAGATCAAGTGGCTCCTGTGTTTTATACTATT
GTGATTCCCATGCTGAATCCACTCATTTATAGTCTTAGAAACAGAGAAGTGAAAAATGCT
CTCATTAGAGTCATGCAGAGAAGACAGGACTCCAGG
Conceptual translation MMGRRNDTNVADFILTGLSDSEEVQMALFMLFLLIYLITMLGNVGMLLIIRLDLQLHTPM
YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFCFVFLGTAECYLLSSMAY
DRYAAICSPLHYTVIMPKRLCLALITGPYVIGFMDSFVNVVSMSRLHFCDSNIIHHFFCD
TSPILALSCTDTDNTEMLIFIIAGSTLMVSLITISASYVSILSTILKINSTSGKQKAFST
CVSHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNA
LIRVMQRRQDSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T T/M 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G Q/Q 1000GP (YRI)
11 55,889,895 55,889,895 NS C/T T/M rs61751933 (DbSNP)
11 55,889,987 55,889,987 NS A/C I/L rs7107077 (DbSNP)
11 55,890,156 55,890,156 NS G/T C/F rs61746202 (DbSNP)
11 55,890,257 55,890,257 NS C/T P/S rs1842691 (DbSNP)
11 55,890,273 55,890,273 NS C/T P/L rs61743852 (DbSNP)
11 55,890,297 55,890,297 NS G/T G/V rs61743843 (DbSNP)
11 55,890,320 55,890,320 NS C/G L/V rs61743838 (DbSNP)
11 55,890,356 55,890,356 NS G/T D/Y rs61746318 (DbSNP)
11 55,890,449 55,890,449 NS A/G I/V rs17531522 (DbSNP)
11 55,890,571 55,890,571 SYN C/T C/C rs61743017 (DbSNP)
11 55,890,609 55,890,609 NS C/T T/I rs61743026 (DbSNP)
11 55,890,611 55,890,611 NS A/G M/V rs61743031 (DbSNP)
11 55,890,664 55,890,664 SYN A/G Q/Q rs61745899 (DbSNP)
11 55,890,726 55,890,726 NS G/T R/I rs61747871 (DbSNP)
11 55,890,732 55,890,732 NS A/G K/R rs11606538 (DbSNP)
11 55,890,736 55,890,736 SYN A/G E/E rs11604579 (DbSNP)
11 56,122,419 56,122,419 NS C/T T/M 1000GP (CEU, CHBJPT)
11 56,122,657 56,122,657 SYN G/A T/T 1000GP (CHBJPT)
11 56,122,680 56,122,680 NS G/T C/F 1000GP (CEU)
11 56,122,844 56,122,844 NS G/C V/L 1000GP (CEU)
11 56,122,879 56,122,879 SYN T/C C/C 1000GP (CEU)
11 56,122,880 56,122,880 NS G/T D/Y 1000GP (CEU)
11 56,122,973 56,122,973 NS A/G I/V 1000GP (CEU)
11 56,123,133 56,123,133 NS C/T T/I 1000GP (CEU)
11 56,123,256 56,123,256 NS G/A R/K 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 170 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T16M L47I C103F P137S L142P V158L I201V T254I M255V R293I R295K % Freq CORP
1 T L C S L V I T M R R 75.50 0.098
2 M L C S L V I T M R R 10.06 0.098
3 T I C S L V I T M R R 5.53 0.098
4 T L F S P L V I M I R 3.92 0.144
5 T L C S L V I T M R K 2.46 0.098
6 T L C S L V I T V R R 0.61 0.098
7 T L F S L L V I M I R 0.38 0.144
8 T L C S P L V I M I R 0.31 0.144
9 T I C S L V I T M R K 0.23 0.098
10 T L C P L V I T M R R 0.15 0.098
11 M L F S L V I T M R R 0.15 0.098
12 T L F S L V I T M R R 0.15 0.098
13 T L F S P V V I M I R 0.08 0.144
14 T L C S L L I T M R R 0.08 0.098
15 T L F P P L V I M I R 0.08 0.144
16 T L C S L L V T M R R 0.08 0.098
17 T L C S P L V T M R R 0.08 0.098
18 T L F S L L V I M R R 0.08 0.144
19 T L F S P L V I M I K 0.08 0.144

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8H3.aApr07-unspliced main_exon CDS chr11 56,122,373 56,123,308 +
3UTR chr11 56,123,308 56,123,311 +