Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8I1P Olfactory Receptor

Gene Symbol OR8I1P1 (View this gene in GeneCards)
Family 8
Subfamily I
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-176, HsOR11.11.58P, ORL3512
External Ids HGNC: 14828   GeneBank: AF399351, BK004767, NG_004147   ORDB: ORL3512   
Build #39 labels OR8I1P
Chromosomal location 11:56,296,540-56,297,470 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8I2 82.2% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8I2P 81% 307
Mouse Or8i2 77% 304
Rat Or8i2 77% 306
Cow OR8I2 77% 309
Orang OR5E1P 49% 308
Horse OR8I2 78% 309
Chimp OR8I2 81% 309

Sequence information

Nucleotide sequence TTGATATAAACAGCTGGCAGCAATTTCACTGAGGTGACTGTCTTCATCCTCTCTGGATAT
GCAAATCACCCTGAATTACAAGTCAGTTTTTTCTTGATGTTTCTCTTCATTTATCTATTC
ACTATTTTGGGAAACCTGGGACTGATCATGTTAATCAGAATGGATTCTCAGCTTCACACC
CCTATGTACTTTTTCCTCAGCAATTTAGCATTCATTGACATATTTTACTCCTCTTCCGTA
ACACCTAAGACATTGGCGAATTTCCAATCCAATCAGAGATCCATCTCCTTTGTTGGCTGC
TTTGTTCAAATGTACTTTTCTGTTGGATTGGTGTGTACTGAGTGTTTCCTGCTGGGATCA
ATGGCCTATGATTGCTATGTAGCAATCTGGAATCCCTCATTCAGTAGTCATTTCTTAGAA
AGCGTGCAACTGGCTGGGAGTAATGTCATACACGATAGGTTTCACAAATTCTCTGGTATC
TGTCTGTGTGATAAGTGGTTTTGTTCTGTGATTCCAGCATCAATCTTTTTTTTCTGTGAC
ACCACAGCTCTTTTAGCACTGTCCTGTGTAGATGCATTCAGCACAGAAATGGTGAGCTTT
GCCTTAGCTGGATTCACTCTTCTTGGCTCTATCCTTATCATCACAGTCACTTATATCGCC
ATCACCTCAGCCATCCTGAAGAACCAGTGGGCAGCAGGATGGCAGAAGGCCTTCTCCACC
TGCGCATTCCACCTCATGGGTTAACTATCTTCTATGGGTCCCTGATTTTCACCTATTTGC
AACTGGATAAAACATCATCCCTGATCCACGCACAGTTGGCATTTGTATTCTATATGACTG
TCATTCCCATGCTGAATCCACTCATCTAGAGTCTGAGGAACAAAGATGTAAAAAATGCTC
TTTGAGAGTCATACATAGAAAACTTTTTCCA
Conceptual translation LIXAGSNFTEVTVFILSGYANHPELQVSFFLMFLFIYLFTILGNLGLIMLIRMDSQLHT
PMYFFLSNLAFIDIFYSSSVTPKTLANFQSNQRSISFVGCFVQMYFSVGLVCTECFLLGS
MAYDCYVAIWNP\SVVISXACNWLGVMSYTIGFTNSLVSVCVI\VLFCDSSIN\FF
CDTTALLALSCVDAFSTEMVSFALAGFTLLGSILIITVTYIAITSAILKNQWAAGWQKAF
STCAFHL/GLTIFYGSLIFTYLQLDKTSSLIHAQLAFVFYMTVIPMLNPLIXLRNKDV
KNAL/RVIHRKLFP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,064,088 56,064,088 SNP G/A rs61736205 (DbSNP)
11 56,064,163 56,064,163 SNP A/G rs17613241 (DbSNP)
11 56,064,316 56,064,316 SNP G/T rs17541133 (DbSNP)
11 56,296,687 56,296,687 SNP A/G 1000GP (CEU)
11 56,296,840 56,296,840 SNP T/G 1000GP (CEU)
11 56,296,995 56,296,995 SNP C/T 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.