Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8I2 Olfactory Receptor

Gene Symbol OR8I21 (View this gene in GeneCards)
Family 8
Subfamily I
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-170, HsOR11.11.45, ORL3409
External Ids HGNC: 15310   GeneBank: AB065656, AB065844, AF399513, BK004342, NM_001003750   ORDB: ORL3409   
Build #39 labels OR8I2
Chromosomal location 11:56,093,308-56,094,237 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8I1P 82.2% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8I2P 90% 308
Chimp CONTIG970.14-23384 97% 310
Mouse Or8i2 86% 307
Rat Or8i2 86% 309
Cow OR8I2 85% 310

Expression evidences

Source Accession
mRNA BC137008

Sequence information

Nucleotide sequence ATGGCTGGCAACAATTTCACTGAGGTTACCGTCTTCATCCTCTCTGGATTTGCAAATCAC
CCTGAATTACAAGTCAGTCTTTTCTTGATGTTTCTCTTCATTTATCTATTCACTGTTTTG
GGAAACCTGGGACTGATCACGTTAATCAGAATGGATTCTCAGCTTCACACCCCTATGTAC
TTTTTCCTGAGCAATTTAGCATTTATTGACATATTTTACTCCTCTACTGTAACACCTAAG
GCATTGGTGAATTTCCAATCCAATCGGAGATCCATCTCCTTTGTTGGCTGCTTTGTTCAA
ATGTACTTTTTTGTTGGATTGGTGTGTTGTGAGTGTTTCCTTCTGGGATCAATGGCCTAC
AATCGCTACATAGCAATCTGCAATCCCTTACTGTATTCAGTAGTCATGTCCCAAAAAGTG
TCCAACTGGCTGGGAGTAATGCCATATGTGATAGGCTTCACAAGCTCGCTGATATCTGTC
TGGGTGATAAGCAGTTTGGCGTTCTGTGATTCCAGCATCAATCATTTTTTTTGTGACACC
ACAGCTCTTTTAGCACTCTCCTGTGTAGATACATTCGGCACAGAAATGGTGAGCTTTGTC
TTAGCTGGATTCACTCTTCTTAGCTCTCTCCTTATCATCACAGTCACTTATATCATCATC
ATCTCAGCCATCCTGAGGATCCAGTCAGCAGCAGGCAGGCAGAAGGCCTTCTCCACCTGC
GCATCCCACCTCATGGCTGTAACTATCTTTTATGGGTCTCTGATTTTCACCTATTTGCAA
CCTGATAACACATCATCGCTGACCCAGGCGCAGGTGGCATCTGTATTCTATACGATTGTC
ATTCCCATGCTGAATCCACTCATCTACAGTCTGAGGAACAAAGATGTGAAAAATGCTCTT
CTGAGAGTCATACATAGAAAACTTTTTCCA
Conceptual translation MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAY
NRYIAICNPLLYSVVMSQKVSNWLGVMPYVIGFTSSLISVWVISSLAFCDSSINHFFCDT
TALLALSCVDTFGTEMVSFVLAGFTLLSSLLIITVTYIIIISAILRIQSAAGRQKAFSTC
ASHLMAVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKLFP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T K/N 1000GP (YRI, YRI, YRI)
11 100 -100 SYN G/A S/S 1000GP (YRI)
11 55,861,153 55,861,153 NS A/G I/V rs17603011 (DbSNP)
11 55,861,200 55,861,200 NS A/T K/N rs17150021 (DbSNP)
11 55,861,484 55,861,484 NS A/C Q/P rs61887096 (DbSNP)
11 55,861,650 55,861,650 nonsense SNP C/G Y/* rs61887097 (DbSNP)
11 56,093,677 56,093,677 NS A/G I/V 1000GP (CEU)
11 56,093,821 56,093,821 NS A/G S/G 1000GP (CEU)
11 56,093,831 56,093,831 NS A/T H/L 1000GP (CEU)
11 56,094,008 56,094,008 NS A/C Q/P 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C110S I124V K139N Q234P S266L % Freq CORP
1 C I K Q S 90.32 1.000
2 C V K P S 4.30 1.000
3 C I N Q S 4.07 1.000
4 S I K Q S 0.46 1.000
5 C V K Q S 0.46 1.000
6 C V K P L 0.31 1.000
7 C I K Q L 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8I2.aApr07-unspliced main_exon CDS chr11 56,093,308 56,094,237 +
3UTR chr11 56,094,237 56,094,240 +