Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8K1 Olfactory Receptor

Gene Symbol OR8K11 (View this gene in GeneCards)
Family 8
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.84 (pseudogene)
Aliases OR11-182, HsOR11.11.61, ORL3321
External Ids HGNC: 14831   GeneBank: AB065835, AF399517, BK004339, NM_001002907, XM_372396   ORDB: ORL3321   
Build #39 labels OR8K1
Chromosomal location 11:56,346,039-56,346,995 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8K3 68.83% 308
OR8K5 64.29% 308
OR8V1P 66.56% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8K1 85% 318
Chimp CONTIG970.5-2860 67% 305
Chimp CONTIG970.10-456 65% 287
Chimp CONTIG7324.1-6402 60% 302
Mouse Or8k1 82% 312
Rat Or8k1 82% 313
Cow OR8K1 85% 318
Cow OR8K1B 85% 313

Expression evidences

Source Accession
mRNA BC146844

Sequence information

Nucleotide sequence ATGAATCATGTGGTAAAACACAATCACACGGCAGTGACCAAGGTGACTGAATTTATTCTC
ATGGGGATTACAGACAACCCTGGGCTGCAGGCTCCACTGTTTGGACTCTTCCTCATCATA
TATCTGGTCACAGTGATAGGCAATCTGGGCATGGTTATCTTGACCTACTTGGACTCCAAG
CTACACACCCCCATGTACTTTTTCCTTAGACATTTGTCAATCACTGATCTTGGTTACTCC
ACTGTCATTGCCCCGAAGATGTTAGTAAACTTCATAGTGCACAAAAACACAATTTCTTAC
AATTGGTATGCCACTCAGCTAGCATTCTTTGAGATTTTCATCATCTCTGAGCTCTTTATT
CTATCAGCAATGGCCTATGATCGCTACGTAGCCATCTGTAAACCTCTTCTGTACGTGATC
ATCATGGCAGAGAAAGTACTTTGGGTGCTGGTAATTGTTCCCTATCTCTATAGCACGTTT
GTGTCACTATTTCTCACAATTAAGTTATTTAAACTGTCCTTCTGTGGCTCAAACATAATC
AGCTATTTTTACTGTGACTGTATCCCTCTGATGTCCATACTCTGTTCTGACACAAATGAA
TTAGAATTAATAATTTTGATCTTCTCAGGCTGTAATTTGCTCTTCTCCCTCTCAATTGTT
CTCATATCCTACATGTTTATTCTAGTGGCCATTCTCAGAATGAACTCAAGGAAAGGGAGG
TACAAAGCCTTCTCCACCTGTAGCTCTCATCTGACAGTGGTGATCATGTTCTATGGGACA
TTGTTATTTATTTACTTGCAACCCAAGTCCAGTCATACTTTGGCTATTGATAAAATGGCC
TCAGTGTTTTATACCCTGTTGATTCCTATGCTGAATCCGTTGATCTACAGCCTAAGGAAC
AAAGAAGTAAAAGATGCTCTAAAGAGAACTTTAACCAATCGATTCAAAATTCCCATT
Conceptual translation MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK
LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI
LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII
SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR
YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN
KEVKDALKRTLTNRFKIPI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C M/T 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A P/P 1000GP (YRI)
11 56,113,516 56,113,516 NS T/C M/T rs1905055 (DbSNP)
11 56,113,575 56,113,575 NS A/G M/V rs10896271 (DbSNP)
11 56,113,593 56,113,593 NS A/C T/P rs10896272 (DbSNP)
11 56,113,764 56,113,764 NS A/G T/A rs17614327 (DbSNP)
11 56,113,769 56,113,769 SYN A/G P/P rs17150344 (DbSNP)
11 56,113,923 56,113,923 SYN C/T L/L rs61745885 (DbSNP)
11 56,346,040 56,346,040 NS T/C M/T 1000GP (CEU, CHBJPT)
11 56,346,099 56,346,099 NS A/G M/V 1000GP (CEU, CHBJPT)
11 56,346,117 56,346,117 NS C/A P/T 1000GP (CEU, CHBJPT)
11 56,346,172 56,346,172 NS T/G V/G 1000GP (CHBJPT)
11 56,346,288 56,346,288 NS G/A A/T 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M1T M21V P27T V45G A84T L217F I219T % Freq CORP
1 T V T V A L I 40.09 1.200
2 T M P V A L I 26.65 1.200
3 M M P V A L I 24.35 0.917
4 T M P V T L I 4.99 1.200
5 T V P V A L I 1.15 1.200
6 T V T G A L I 0.61 1.200
7 T M P V A F I 0.61 1.200
8 T M T V A L I 0.54 2.000
9 T M P V A L T 0.38 1.200
10 M M T V A L I 0.23 0.917
11 M M P V T L I 0.23 0.917
12 M V T V A L I 0.08 0.917
13 T V P V T L I 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8K1.aApr07-unspliced main_exon CDS chr11 56,346,039 56,346,995 +
3UTR chr11 56,346,995 56,346,998 +