Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8K5 Olfactory Receptor

Gene Symbol OR8K51 (View this gene in GeneCards)
Family 8
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR11-174, HsOR11.11.49, ORL3330
External Ids HGNC: 15315   GeneBank: AB065542, BK004347, NM_001004058   ORDB: ORL3330   
Build #39 labels OR8K5
Chromosomal location 11:56,159,397-56,160,317 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8K3 70.03% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8K5 83% 300
Chimp CONTIG970.10-456 98% 287
Mouse Or8k20 76% 307
Rat Or8k16c 77% 307
Cow OR8K5 83% 307
Cow OR8K5B 82% 294

Expression evidences

Source Accession
GNF Atlas2 gnf1h10676_at

Sequence information

Nucleotide sequence ATGGGCCAACACAATCTAACAGTGCTAACTGAATTCATTCTGATGGAACTCACAAGGCGG
CCTGAGCTGCAGATTCCCCTTTTTGGAGTCTTCCTCGTCATCTACCTAATCACAGTGGTG
GGCAACCTAACTATGATCATTTTGACCAAACTGGACTCCCACTTACATACACCTATGTAC
TTTTCTATCAGACATTTGGCTTTTGTTGATCTTGGTAATTCTACTGTCATTTGTCCCAAG
GTGCTGGCAAATTTTGTTGTGGATCGAAATACTATTTCCTATTATGCATGTGCTGCACAG
CTGGCATTCTTCCTTATGTTCATTATCAGTGAATTTTTCATCCTGTCAGCCATGGCCTAT
GACCGCTATGTGGCCATTTGTAACCCTCTGCTCTATTATGTTATTATGTCTCAGCGACTG
TGTCATGTACTGGTGGGCATTCAATATCTCTACAGCACATTTCAGGCTCTGATGTTCACT
ATTAAGATTTTTACATTGACCTTCTGTGGCTCTAATGTCATCAGTCATTTTTACTGTGAT
GATGTTCCTTTGCTACCTATGCTTTGCTCAAATGCACAGGAAATAGAATTGTTGAGCATA
CTATTTTCTGTATTTAATTTGATCTCCTCCTTTCTGATAGTCTTAGTGTCCTACATGTTG
ATTTTGTTAGCTATATGTCAAATGCATTCTGCAGAGGGCAGGAAAAAGGCTTTCTCCACA
TGTGGTTCCCATTTGACAGTGGTGGTTGTGTTCTATGGGTCTCTACTCTTCATGTACATG
CAGCCCAATTCCACTCACTTCTTTGATACTGATAAAATGGCTTCTGTGTTTTACACTTTA
GTAATCCCCATGCTTAACCCTTTGATTTACAGCTTAAGAAACGAAGAGGTGAAAAATGCC
TTCTATAAGCTCTTTGAGAAT
Conceptual translation MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMY
FSIRHLAFVDLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAY
DRYVAICNPLLYYVIMSQRLCHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCD
DVPLLPMLCSNAQEIELLSILFSVFNLISSFLIVLVSYMLILLAICQMHSAEGRKKAFST
CGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNA
FYKLFEN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C M/V 1000GP (YRI, YRI)
11 100 -100 SYN G/A T/T 1000GP (YRI)
11 55,926,999 55,926,999 SYN G/A T/T rs61746296 (DbSNP)
11 55,927,442 55,927,442 NS T/C M/V rs61746523 (DbSNP)
11 55,927,591 55,927,591 NS A/G F/S rs2512938 (DbSNP)
11 56,159,966 56,159,966 NS T/C M/V 1000GP (CEU)
11 56,160,287 56,160,287 NS C/T E/K 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 243 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D121E M118V D70E F68S R20W E11K % Freq CORP
1 D M D F R E 88.56 0.198
2 D V D F R E 4.84 0.498
3 D M D F R K 3.76 0.198
4 D M D S R E 2.23 0.198
5 E M D F R E 0.31 1.000
6 D M E F R E 0.15 0.198
7 D M D F W E 0.15 0.198

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8K5.aApr07-unspliced main_exon 3UTR chr11 56,159,394 56,159,397 -
CDS chr11 56,159,397 56,160,317 -