Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8S1 Olfactory Receptor

Gene Symbol OR8S11 (View this gene in GeneCards)
Family 8
Subfamily S
Pseudogene No
CORP pseudogene probability score
Aliases HsOR12.3.6
External Ids HGNC: 19628   GeneBank: NM_001005203   
Build #39 labels OR8S1
Chromosomal location 12:48,525,632-48,526,567 (+)
Cluster 12@49b
Synteny CLIC#30
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8T1P 69.54% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8S1 84% 311
Chimp CONTIG1216.55-2416 97% 269
Mouse Or8t1 71% 304
Rat Or8s10 69% 307
Cow OR8S1 86% 311

Expression evidences

Source Accession
GNF Atlas2 gnf1h02608_at

Sequence information

Nucleotide sequence ATGGCCTTGGGGAATCACAGCACCATCACCGAGTTCCTCCTCCTTGGGCTGTCTGCCGAC
CCCAACATCCGGGCTCTGCTCTTTGTGCTGTTCCTGGGGATTTACCTCCTGACCATAATG
GAAAACCTGATGCTGCTGCTCATGATCAGGGCTGATTCTTGTCTCCATAAGCCCATGTAT
TTCTTCCTGAGTCACCTCTCTTTTGTTGATCTCTGCTTCTCTTCAGTCATTGTGCCCAAG
ATGCTGGAGAACCTCCTGTCACAGAGGAAAACCATTTCAGTAGAGGGCTGCCTGGCTCAG
GTCTTCTTTGTGTTTGTCACTGCAGGGACTGAAGCCTGCCTTCTCTCAGGGATGGCCTAT
GACCGCCATGCTGCCATCTGCCGCCCACTACTTTATGGACAGATCATGGGTAAACAGCTG
TATATGCACCTTGTGTGGGGCTCATGGGGACTGGGCTTTCTGGACGCACTCATCAATGTC
CTCCTAGCTGTAAACATGGTCTTTTGTGAAGCCAAAATCATTCACCACTACAGCTATGAG
ATGCCATCCCTCCTCCCTCTGTCCTGCTCTGATATCTCCAGAAGCCTCATCGCCTTGCTC
TGCTCCACTCTCCTACATGGGCTGGGAAACTTCCTTTTGGTCTTCTTATCCTACACCCGT
ATAATCTCTACCATCCTAAGCATCAGCTCTACCTCGGGCAGAAGCAAGGCCTTCTCCACC
TGCTCTGCCCACCTCACTGCAGTGACACTTTACTATGGCTCAGGTTTGCTCCGCCATCTC
ATGCCAAACTCAGGTTCCCCCATAGAGTTGATCTTCTCTGTGCAGTATACTGTAGTCACT
CCCATGCTGAATTCCCTCATCTATAGCCTGAAAAATAAGGAAGTGAAGGTAGCTCTGAAA
AGAACTTTGGAAAAATATTTGCAATATACCAGACGT
Conceptual translation MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLMLLLMIRADSCLHKPMY
FFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFVFVTAGTEACLLSGMAY
DRHAAICRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLAVNMVFCEAKIIHHYSYE
MPSLLPLSCSDISRSLIALLCSTLLHGLGNFLLVFLSYTRIISTILSISSTSGRSKAFST
CSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTPMLNSLIYSLKNKEVKVALK
RTLEKYLQYTRR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS A/G N/S 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
12 100 -100 SYN G/A L/L 1000GP (YRI)
12 48,525,773 48,525,773 NS A/G M/V 1000GP (CEU, CHBJPT)
12 48,525,876 48,525,876 NS T/C L/P 1000GP (CEU, CHBJPT)
12 48,525,877 48,525,877 SYN G/A L/L 1000GP (CEU, CHBJPT)
12 48,526,010 48,526,010 NS T/C C/R 1000GP (CEU, CHBJPT)
12 48,526,013 48,526,013 NS C/T R/C 1000GP (CEU, CHBJPT)
12 48,526,108 48,526,108 SYN T/C N/N 1000GP (CHBJPT)
12 48,526,223 48,526,223 NS G/A A/T 1000GP (CEU, CHBJPT)
12 48,526,290 48,526,290 NS G/A R/H 1000GP (CEU, CHBJPT)
12 48,919,556 48,919,556 NS A/G M/V rs2731073 (DbSNP)
12 48,919,659 48,919,659 NS T/C L/P rs4075258 (DbSNP)
12 48,919,659 48,919,660 mnp CA/TG rs71439450 (DbSNP)
12 48,919,660 48,919,660 SYN A/G L/L rs35367885 (DbSNP)
12 48,919,778 48,919,778 NS T/C C/R rs4075259 (DbSNP)
12 48,919,793 48,919,793 NS T/C C/R rs2705143 (DbSNP)
12 48,919,796 48,919,796 NS C/T R/C rs12425460 (DbSNP)
12 48,920,006 48,920,006 NS A/G T/A rs12425518 (DbSNP)
12 48,920,073 48,920,073 NS A/G H/R rs61941963 (DbSNP)
12 48,920,261 48,920,261 NS C/G L/V rs59116841 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 226 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N5S E11K M48V L82P C127R A198T R220H I268T L283V R312H % Freq CORP
1 N E V P C T R I L R 28.65 0.837
2 N E V P C A R I L R 28.11 0.837
3 N E V L R A R I L R 21.04 0.872
4 N E V L C A H I L R 9.98 0.872
5 N E M L C A R I L R 7.76 0.872
6 N E V L C A R I L R 2.15 0.872
7 S E V P C T R I L R 0.92 0.837
8 N E V P C A R I V R 0.54 0.837
9 N E V L R A R I L H 0.15 0.872
10 N E V L C T R I L R 0.15 0.872
11 N E V L R A H I L R 0.15 0.872
12 N E V L R A R T L R 0.08 0.872
13 N E V P C T R T L R 0.08 0.837
14 N E V L C A R I L H 0.08 0.872
15 N E M P C T R I L R 0.08 0.837
16 N K V P C T R I L R 0.08 0.837

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8S1.aApr07 exon_3UTR chr12 48,527,912 48,528,103 +