Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8U8 Olfactory Receptor

Gene Symbol OR8U81 (View this gene in GeneCards)
Family 8
Subfamily U
Pseudogene No
CORP pseudogene probability score
Aliases
External Ids HGNC: 27538   
Build #39 labels
Chromosomal location :- ()
Cluster
Synteny CLIC#0
Remarks no location in hg. 19

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8U9 88% 308
Dog OR8U8 89% 309
Mouse Or8u8 87% 308
Mouse Or8u9 85% 308
Rat Or8u8 86% 308
Rat Or8u9 84% 308
Cow OR8U1 85% 308
Cow OR8U1B 85% 308
Cow OR8U9 83% 308

Sequence information

Nucleotide sequence ATGGCTCACATCAATTGCACCCAGGCGACAGAGTTTATTCTTGTGGGCCTCACAGACCAT
CAGGAGTTGAAGATGCCCCTCTTTGTGCTATTCTTATCCATCTACCTCTTCACAGTGGTA
GGCAACTTGGGTTTGATCCTACTCATTAGAGCGGATACAAGTCTCAACACACCAATGTAC
TTCTTTCTTAGCAACCTAGCTTTTGTGGATTTCTGTTACTCTTCTGTCATTACACCCAAA
ATGCTTGGGAATTTCTTGTACAAACAAAATGTTATATCCTTTGATGCATGTGCTACTCAA
CTGGGCTGCTTTCTCACCTTCATGATATCAGAATCCTTGCTACTGGCTTCCATGGCCTAT
GACCGATATGTGGCCATTTGTAACCCTCTATTGTATATGGTTGTAATGACTCCAGGAATC
TGCATTCAACTTGTAGCAGTTCCTTATAGCTATAGCTTCCTAATGGCACTATTTCACACC
ATCCTCACCTTCCGCCTCTCCTATTGCCACTCCAACATTGTCAACCATTTCTATTGTGAT
GACATGCCTCTCCTCAGGCTAACTTGCTCAGACACTCGCTTCAAACAGCTATGGATTTTG
GCCTGTGCTGGTATCACATTCATCTGCTCTGTTCTGATTGTCTTTGTCTCCTACATGTTC
ATTATTTTTGCCATCCTGAGGATGAGCTCAGCTGAAGGAAGACGCAAAGCCTTCTCCACC
TGTAGCTCTCACATGCTGGCAGTCACCATATTCTATGGCACCCTGATCTTTATGTACTTA
CAACCAAGCTCAAGCCATTCTCTTGATGCAGACAAGATGGCCTCTGTCTTCTACACGGTG
ATTATTCCCATGTTGAATCCCTTGATTTACAGTCTCAGGAACAAAGATGTAAAAGATGCC
CTGAAGAAAGTCATCATCAATAGA
Conceptual translation MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY
DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD
DMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFST
CSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDA
LKKVIINR

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
Deletion 260 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.