Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9A2 Olfactory Receptor

Gene Symbol OR9A21 (View this gene in GeneCards)
Family 9
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases OR7-2, HsOR7.6.1P, ORL3173
External Ids HGNC: 15093   GeneBank: AB065696, AB065874, AY284261-AY284292, BK004391, NM_001001658   ORDB: ORL3173   
Build #39 labels OR9A2
Chromosomal location 7:143,026,203-143,027,132 (-)
Cluster 7@143a
Synteny CLIC#15
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9A1P 74.29% 315
OR9A3P 74.67% 300
OR9A4 78.34% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9A4 79% 315
Chimp CONTIG*********** 97% 310
Mouse Or9a2 80% 315
Rat Or9a4 76% 315
Cow OR9A16 79% 317

Expression evidences

Source Accession
ESTs EG357679
mRNA BC137049
GNF Atlas2 gnf1h10924_at

Sequence information

Nucleotide sequence ATGATGGACAACCACTCTAGTGCCACTGAATTCCACCTTCTAGGCTTCCCTGGGTCCCAA
GGACTACACCACATTCTTTTTGCTATATTCTTTTTCTTCTATTTAGTGACATTAATGGGA
AACACGGTCATCATTGTGATTGTCTGTGTGGATAAACGTCTGCAGTCCCCCATGTATTTC
TTCCTCAGCCACCTCTCTACCCTGGAGATCCTGGTCACAACCATAATTGTCCCCATGATG
CTTTGGGGATTGCTCTTCCTGGGATGCAGACAGTATCTTTCTCTACATGTATCGCTCAAC
TTTTCCTGTGGGACCATGGAGTTTGCATTACTTGGAGTGATGGCTGTGGACCGTTATGTG
GCTGTGTGTAACCCTTTGAGGTACAACATCATTATGAACAGCAGTACCTGTATTTGGGTG
GTAATAGTGTCATGGGTGTTTGGATTTCTTTCTGAAATCTGGCCCATCTATGCCACATTT
CAGTTTACCTTCCGCAAATCAAATTCATTAGACCATTTTTACTGTGACCGAGGGCAATTG
CTCAAACTGTCCTGCGATAACACTCTTCTCACAGAGTTTATCCTTTTCTTAATGGCTGTT
TTTATTCTCATTGGTTCTTTGATCCCTACGATTGTCTCCTACACCTACATTATCTCCACC
ATCCTCAAGATCCCGTCAGCCTCTGGCCGGAGGAAAGCCTTCTCCACTTTTGCCTCCCAC
TTCACCTGTGTTGTGATTGGCTATGGCAGCTGCTTGTTTCTCTACGTGAAACCCAAGCAA
ACACAGGGAGTTGAGTACAATAAGATAGTTTCCCTGTTGGTTTCTGTGTTAACCCCCTTC
CTGAATCCTTTCATCTTTACTCTTCGGAATGACAAAGTCAAAGAGGCCCTCCGAGATGGG
ATGAAACGCTGCTGTCAACTCCTGAAAGAT
Conceptual translation MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCVDKRLQSPMYF
FLSHLSTLEILVTTIIVPMMLWGLLFLGCRQYLSLHVSLNFSCGTMEFALLGVMAVDRYV
AVCNPLRYNIIMNSSTCIWVVIVSWVFGFLSEIWPIYATFQFTFRKSNSLDHFYCDRGQL
LKLSCDNTLLTEFILFLMAVFILIGSLIPTIVSYTYIISTILKIPSASGRRKAFSTFASH
FTCVVIGYGSCLFLYVKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDG
MKRCCQLLKD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS C/T R/Q 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
7 100 -100 SYN A/C L/L 1000GP (YRI)
7 142,723,695 142,723,695 NS A/C C/W rs35155408 (DbSNP)
7 142,724,062 142,724,062 NS C/T R/H rs9885986 (DbSNP)
7 142,724,142 142,724,142 SYN A/C L/L rs60968042 (DbSNP)
7 142,724,195 142,724,195 NS C/T A/T rs34203442 (DbSNP)
7 143,026,975 143,026,975 NS C/T R/H 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R298Q S239P R165C R53H I29V % Freq CORP
1 R S R R I 90.78 0.999
2 R S R H I 8.14 0.999
3 Q S R R I 0.54 0.999
4 R P R R I 0.31 0.991
5 R S C R I 0.15 0.999
6 R S R R V 0.08 0.999

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9A2.aApr07-unspliced main_exon 3UTR chr7 143,025,463 143,026,203 -
CDS chr7 143,026,203 143,027,132 -
5UTR chr7 143,027,132 143,027,152 -