Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9A4 Olfactory Receptor

Gene Symbol OR9A41 (View this gene in GeneCards)
Family 9
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR7-1, HsOR7.5.3, ORL3174
External Ids HGNC: 15095   GeneBank: AB065689, BK004278, NM_001001656   ORDB: ORL3174   
Build #39 labels OR9A4
Chromosomal location 7:141,918,876-141,919,817 (+)
Cluster 7@142
Synteny CLIC#14
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9A2 78.34% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9A4 89% 314
Chimp CONTIG*********** 78% 314
Chimp CONTIG362.108-3150 75% 314
Chimp CONTIG362.106-663 74% 303
Mouse Or9a4 84% 314
Rat Or9a4 83% 314
Cow OR9A4 87% 314

Expression evidences

Source Accession
ESTs DA828273
mRNA BC136821
GNF Atlas2 gnf1h04815_at

Sequence information

Nucleotide sequence ATGTTGATGAATTACTCTAGTGCCACTGAATTTTATCTCCTTGGCTTCCCTGGCTCTGAA
GAACTACATCATATCCTTTTTGCTATATTCTTCTTTTTCTACTTGGTGACATTAATGGGA
AACACAGTCATCATCATGATTGTCTGTGTGGATAAACGTCTGCAGTCCCCCATGTATTTC
TTCCTCGGCCACCTCTCTGCCCTGGAGATCCTGGTCACAACCATAATCGTCCCCGTGATG
CTTTGGGGATTGCTGCTCCCTGGGATGCAGACAATATATTTGTCTGCCTGTGTTGTCCAG
CTCTTCTTGTACCTTGCTGTGGGGACAACAGAGTTCGCATTACTTGGAGCAATGGCTGTG
GACCGTTATGTGGCTGTCTGTAACCCTCTGAGGTACAACATCATTATGAACAGACACACC
TGCAACTTTGTGGTTCTTGTGTCATGGGTGTTTGGGTTTCTTTTTCAAATCTGGCCGGTC
TATGTCATGTTTCAGCTTACTTACTGCAAATCAAATGTGGTGAACAATTTTTTTTGTGAC
CGAGGGCAATTGCTCAAACTATCCTGCAATAATACTCTTTTCACGGAGTTTATCCTCTTC
TTAATGGCTGTTTTTGTTCTCTTTGGTTCTTTGATCCCTACAATTGTCTCCAACGCCTAC
ATCATCTCCACCATTCTCAAGATCCCGTCATCCTCTGGCCGGAGGAAATCCTTCTCCACT
TGTGCCTCCCACTTCACCTGTGTTGTGATTGGCTACGGCAGCTGCTTGTTTCTCTACGTG
AAACCCAAGCAAACGCAGGCAGCTGATTACAATTGGGTAGTTTCCCTGATGGTTTCAGTA
GTAACTCCTTTCCTCAATCCTTTCATCTTCACCCTCCGGAATGATAAAGTCATAGAGGCC
CTTCGGGATGGGGTGAAACGCTGCTGTCAACTATTCAGGAAT
Conceptual translation MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYF
FLGHLSALEILVTTIIVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAV
DRYVAVCNPLRYNIIMNRHTCNFVVLVSWVFGFLFQIWPVYVMFQLTYCKSNVVNNFFCD
RGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTILKIPSSSGRRKSFST
CASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA
LRDGVKRCCQLFRN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 nonsense SNP C/T Q/* 1000GP (YRI)
7 100 -100 NS T/C Y/H 1000GP (YRI, YRI)
7 100 -100 SYN C/T F/F 1000GP (YRI, YRI, YRI)
7 141,619,011 141,619,011 SYN C/T F/F rs73529456 (DbSNP)
7 141,619,035 141,619,035 SYN A/G V/V rs12671371 (DbSNP)
7 141,619,152 141,619,152 SYN A/G P/P rs12671397 (DbSNP)
7 141,619,365 141,619,365 SYN A/G S/S rs73529458 (DbSNP)
7 141,919,150 141,919,150 NS T/C I/T 1000GP (CEU)
7 141,919,235 141,919,235 SYN G/A V/V 1000GP (CHBJPT)
7 141,919,589 141,919,589 SYN C/T F/F 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
7 141,602,319 141,642,997 CopyNumber Variation_36625 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L86I Y123H % Freq CORP
1 L Y 96.55 1.000
2 I Y 1.72 1.000
3 L H 1.72 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9A4.aApr07-unspliced main_exon CDS chr7 141,918,876 141,919,817 +
3UTR chr7 141,919,817 141,919,820 +