Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9G1 Olfactory Receptor

Gene Symbol OR9G11 (View this gene in GeneCards)
Family 9
Subfamily G
Pseudogene No
CORP pseudogene probability score
Aliases OR11-210, OR11-114, HsOR11.11.87, ORL3449
External Ids HGNC: 15319   GeneBank: AB065500, BK004511, NM_001005213   ORDB: ORL3449   
Build #39 labels OR9G1, OR9G5
Chromosomal location 11:56,700,388-56,701,302 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9G3P 77.15% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9G1B 84% 304
Dog OR9G1 83% 304
Chimp CONTIG229.58-13719 97% 305
Chimp CONTIG*********** 95% 305
Mouse Or9g8 77% 303
Rat Or9g20 77% 304
Cow OR9G1 81% 303

Expression evidences

Source Accession
mRNA AB463984

Sequence information

Nucleotide sequence ATGCAGAGGAGCAATCATACAGTGACTGAGTTTATACTGCTGGGCTTCACCACAGACCCA
GGAATGCAGCTGGGCCTCTTCGTGGTGTTCCTGGGCGTGTACTCTCTCACTGTGGTAGGA
AATAGCACCCTCATCGTGTTGATCTGTAATGACTCCTGCCTCCACACACCCATGTATTTT
TTCACTGGAAATCTGTCGTTTCTGGATCTCTGGTATTCTTCTGTCTACACCCCAAAGATC
CTAGTGACCTGCATCTCTGAAGACAAAAGCATCTCCTTTGCTGGCTGCCTGTGTCAGTTC
TTCTTCTCTGCAGGGCTGGCCTATAGTGAGTGCTACCTGCTGGCTGCCGTGGCTTATGAC
CGCTACGTGGCCATCTCCAAGCCCCTGCTTTATGCCCAGGCCATGTCCATAAAGCTGTGT
GCATTGCTGGTAGCAGTCTCATATTGTGGTGGCTTTATTAACTCTTCAATCATCACCAAG
AAAACGTTTTCCTTTAACTTCTGCCGTGAAAACATCATTGATGACTTTTTCTGTGATTTG
CTTCCCTTGGTGGAGCTGGCCTGTGGCGAGAAGGGCGGCTATAAAATTATGATGTACTTC
CTGCTGGCCTCCAATGTCATCTGCCCCGCAGTGCTCATCCTGGCCTCCTACCTCTTTATC
ATCACCAGTGTCTTGAGGATCTCCTCCTCCAAGGGCTACCTCAAAGCCTTCTCCACATGC
TCCTCCCACCTGACCTCTGTCACTTTATACTATGGCTCCATTCTCTACATCTACGCTCTC
CCCAGATCTAGCTATTCTTTTGATATGGACAAAATAGTTTCTACATTTTACACTGTGGTA
TTCCCCATGTTGAATCTCATGATCTACAGCCTAAGGAATAAGGATGTGAAAGAGGCTCTG
AAAAAACTTCTCCCA
Conceptual translation MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSCLHTPMYF
FTGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLCQFFFSAGLAYSECYLLAAVAYD
RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCRENIIDDFFCDL
LPLVELACGEKGGYKIMMYFLLASNVICPAVLILASYLFIITSVLRISSSKGYLKAFSTC
SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEAL
KKLLP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C C/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G A/A 1000GP (YRI, YRI)
11 56,467,881 56,467,881 SYN C/T H/H rs73474900 (DbSNP)
11 56,467,926 56,467,926 SYN G/A G/G rs1704284 (DbSNP)
11 56,467,945 56,467,945 NS G/T V/L rs36184181 (DbSNP)
11 56,468,020 56,468,020 NS T/C C/R rs532637 (DbSNP)
11 56,468,021 56,468,021 NS G/A C/Y rs532635 (DbSNP)
11 56,468,044 56,468,044 NS G/T V/F rs3975155 (DbSNP)
11 56,468,047 56,468,047 NS A/G T/A rs2865519 (DbSNP)
11 56,468,047 56,468,048 mnp AC/GT rs71458233 (DbSNP)
11 56,468,048 56,468,048 NS C/T T/I rs2865520 (DbSNP)
11 56,468,089 56,468,089 NS C/T H/Y rs62619921 (DbSNP)
11 56,468,111 56,468,111 NS T/C I/T rs602224 (DbSNP)
11 56,468,155 56,468,155 NS G/T G/C rs11228732 (DbSNP)
11 56,468,198 56,468,198 NS A/G Y/C rs4990194 (DbSNP)
11 56,468,200 56,468,200 SYN C/T L/L rs4990195 (DbSNP)
11 56,468,202 56,468,202 SYN A/G L/L rs4990196 (DbSNP)
11 56,468,212 56,468,212 NS G/A V/M rs591369 (DbSNP)
11 56,468,259 56,468,259 SYN C/T A/A rs503776 (DbSNP)
11 56,468,368 56,468,368 NS C/T R/C rs11228733 (DbSNP)
11 56,468,403 56,468,403 SYN A/G L/L rs11228734 (DbSNP)
11 56,468,416 56,468,416 NS A/G K/E rs11228735 (DbSNP)
11 56,468,440 56,468,440 NS G/T G/C rs12421330 (DbSNP)
11 56,468,493 56,468,493 SYN A/G A/A rs10792053 (DbSNP)
11 56,468,554 56,468,554 NS A/C K/Q rs12420076 (DbSNP)
11 56,468,560 56,468,560 NS C/T H/Y rs10896516 (DbSNP)
11 56,468,560 56,468,561 mnp CG/TA rs34261633 (DbSNP)
11 56,468,561 56,468,561 NS A/G Y/C rs10896517 (DbSNP)
11 56,468,638 56,468,638 NS G/T A/S rs7121276 (DbSNP)
11 56,468,720 56,468,720 NS C/T P/L rs66943455 (DbSNP)
11 56,700,450 56,700,450 SYN A/G G/G 1000GP (CEU)
11 56,700,544 56,700,544 NS T/C C/R 1000GP (CEU, CHBJPT)
11 56,700,545 56,700,545 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 56,700,568 56,700,568 NS T/G F/V 1000GP (CEU, CHBJPT)
11 56,700,571 56,700,571 NS A/G T/A 1000GP (CEU, CHBJPT)
11 56,700,679 56,700,679 NS T/G C/G 1000GP (CHBJPT)
11 56,700,722 56,700,722 NS A/G Y/C 1000GP (CEU, CHBJPT)
11 56,700,724 56,700,724 SYN C/T L/L 1000GP (CEU, CHBJPT)
11 56,700,726 56,700,726 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 56,700,736 56,700,736 NS G/A V/M 1000GP (CEU, CHBJPT)
11 56,700,940 56,700,940 NS G/A E/K 1000GP (CEU)
11 56,701,017 56,701,017 SYN A/G A/A 1000GP (CEU)
11 56,701,161 56,701,161 SYN C/T Y/Y 1000GP (CHBJPT)
11 56,701,218 56,701,218 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
11 56,701,223 56,701,223 NS T/A V/E 1000GP (CHBJPT)
11 56,701,228 56,701,228 NS T/C F/L 1000GP (CEU, CHBJPT)
11 56,701,244 56,701,244 NS T/C L/P 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
Deletion 259 (Hasin)
11 56,460,050 56,475,898 CopyNumber Variation_34985 (DGV)
11 56,460,779 56,473,586 CopyNumber Variation_34986 (DGV)
11 56,467,760 56,508,007 CopyNumber Variation_61151 (DGV)
11 56,467,764 56,470,778 CopyNumber #172 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I12V F61V T62A T62I L212F A259S V279E F281L % Freq CORP
1 I V A I L A V F 37.40 0.982
2 I V A I L A E L 20.43 0.982
3 I F T I L A V F 20.35 0.937
4 I F T I L A E L 12.06 0.937
5 I F T I L S V F 4.61 0.937
6 I F T I L S E L 2.46 0.937
7 I V A I L S E L 0.46 0.982
8 I V A I L A E F 0.38 0.982
9 I V A I L S V F 0.38 0.982
10 I V A I F A V F 0.31 0.982
11 V F T I L A E L 0.23 0.937
12 V F T I L A V F 0.15 0.937
13 I F T I F A V F 0.15 0.937
14 I F T I L A E F 0.15 0.937
15 I V A I F A E L 0.08 0.982
16 I F T I L A V L 0.08 0.937
17 I F T I F A E L 0.08 0.937
18 I F T I F S V F 0.08 0.937
19 V F T I L S E L 0.08 0.937
20 I F T I L S E F 0.08 0.937

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9G1.aApr07-unspliced main_exon CDS chr11 56,700,388 56,701,302 +
3UTR chr11 56,701,302 56,701,305 +