Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9G3P Olfactory Receptor

Gene Symbol OR9G3P1 (View this gene in GeneCards)
Family 9
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-215, OR11-202, HsOR11.11.88P, ORL3566
External Ids HGNC: 15321   GeneBank: BK004512, BK004599, NG_004179   ORDB: ORL3566   
Build #39 labels OR9G3P
Chromosomal location 11:56,740,179-56,741,092 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9G1 77.15% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9G3 84% 302
Chimp CONTIG*********** 94% 307
Mouse Or9g3 83% 307
Rat Or9g3 83% 307
Cow OR9G3 82% 302

Sequence information

Nucleotide sequence ATGCAGAGGAGCAATCACACAGTGACTGAGTTCATCCTGCTGGGCTTCACCACAGATCCA
GGGATGCAACTGGGCCTCTTTGTGGTGTTCCTGGGTGTGTACTGTCTGACTGTGGTAGGA
AGTAGCACCCTCATCGTGTTGATCTGTAATGACTCCCACCTACACACACCCATGTATTTT
GTCATTGGAAATCTGTCATTTCTGGATCTCTGGTATTCTTCTGTCTACACCCCAAAGATC
CTAGTGACCTGCATCTCTGAAGACAAAAGCATCTCCTTTGCTGGCTGCCTGTGTCAGTTC
TTCTCTGCCAGGCTGGCCTATAGTGAGTGCTACCTACTGGCTGCCATGGCTTATGACCAC
TACGTGGCCATCTCCAAGCCCCTGCTTTATGCTCAGACCATGCCAAGGAGATTGTGCATC
TGTTTGGTTTTATATTCCTATACTGGGGGTTTTGTCAATGCAATAATATTAACCAGCAAC
ACATTCACATTGGATTTTTGTGGTGACAATGTCATTGATGACTTTTTCTGTGATGTCCCA
CCCCTCGTGAAGCTGGCATGCAGTGTGAGAGCTACCAGGCTGTGCTGCACTTCCTTCTGG
CCTCCAATGTCATCTCCCCTACTGTGCTCATCCTTGCCTCTTACCTCTCCATCATCACCA
CCATCCTGAGGATCCACTCTACCCAGGGCCGCATCAAAGTCTTCTCCACATGCTCCTCCC
ACCTGATCTCCGTTACCTTATACTATGGCTCCATTCTCTACAACTACTCCCGGCCAAGTT
CCAGCTACTCCCTCAAGAGGGACAAAATGGTTTCTACCTTTTATACTATGCTGTTCCCCA
TGTTGAATCCCATGATCTACAGTCTGAGGAATAAAGACATGAAAGACGCTCTGAAAAAAT
TCTTCAAGTCAGCA
Conceptual translation MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYCLTVVGSSTLIVLICNDSHLHTPMYF
VIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLCQFFSARLAYSECYLLAAMAYDH
YVAISKPLLYAQTMPRRLCIWLVLYSYTGGFVNAIILTSNTFTLDFCGDNVIDDFFCDVP
PLVKLACSVRATRL/LHFLLASNVISPTVLILASYLSIITTILRIHSTQGRIKVFSTCS
SHLISVTLYYGSILYNYSRPSSSYSLKRDKMVSTFYTMLFPMLNPMIYSLRNKDMKDALK
KFFKSA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,508,221 56,508,220 Ins(4) -/GAGA rs35153452 (DbSNP)
11 56,508,226 56,508,225 rescued_Ins(4) -/AGAG rs61678513 (DbSNP)
11 56,508,227 56,508,226 rescued_Ins(4) -/AGAG rs67339930 (DbSNP)
11 56,508,222 56,508,221 rescued_Ins(4) -/GAGA rs67703495 (DbSNP)
11 56,508,226 56,508,226 SNP A/C rs56391658 (DbSNP)
11 56,508,032 56,508,032 SNP A/G rs11228757 (DbSNP)
11 56,507,716 56,507,716 SNP A/G rs61741400 (DbSNP)
11 56,508,386 56,508,386 SNP A/G rs61742386 (DbSNP)
11 56,508,390 56,508,390 SNP C/T rs61742387 (DbSNP)
11 56,508,476 56,508,476 SNP C/T rs11228758 (DbSNP)
11 56,508,191 56,508,191 SNP C/T rs645359 (DbSNP)
11 56,507,880 56,507,880 SNP C/T rs644039 (DbSNP)
11 56,508,541 56,508,541 SNP C/T rs11228759 (DbSNP)
11 56,508,525 56,508,525 SNP G/A rs556056 (DbSNP)
11 56,507,812 56,507,812 SNP G/A rs473032 (DbSNP)
11 56,740,336 56,740,336 SNP A/G 1000GP (CEU, CHBJPT)
11 56,740,340 56,740,340 SNP A/C 1000GP (CEU, CHBJPT)
11 56,740,362 56,740,362 SNP A/G 1000GP (CEU)
11 56,740,376 56,740,376 SNP A/G 1000GP (CEU, CHBJPT)
11 56,740,510 56,740,510 SNP A/G 1000GP (CEU, CHBJPT)
11 56,740,512 56,740,512 SNP C/T 1000GP (CEU, CHBJPT)
11 56,740,537 56,740,537 SNP A/G 1000GP (CEU, CHBJPT)
11 56,740,556 56,740,556 SNP G/A 1000GP (CEU, CHBJPT)
11 56,740,715 56,740,715 SNP C/T 1000GP (CEU, CHBJPT)
11 56,741,000 56,741,000 SNP T/C 1000GP (CEU, CHBJPT)
11 56,741,049 56,741,049 SNP A/G 1000GP (CEU, CHBJPT)
11 56,741,065 56,741,065 SNP C/T 1000GP (CEU, CHBJPT)
11 56,740,211 56,740,211 SNP C/T 1000GP (CHBJPT)
11 56,740,214 56,740,214 SNP C/A 1000GP (CHBJPT)
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 56,467,760 56,508,007 CopyNumber Variation_61151 (DGV)
CopyNumber 102 (Hasin)
11 56,507,555 56,510,568 CopyNumber #69 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.