Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9G4 Olfactory Receptor

Gene Symbol OR9G41 (View this gene in GeneCards)
Family 9
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-216, HsOR11.11.89, ORL3277
External Ids HGNC: 15322   GeneBank: AB065738, AF399530, BK004400, NM_001005284   ORDB: ORL3277   
Build #39 labels OR9G4
Chromosomal location 11:56,742,831-56,743,766 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9G3P 60.98% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9G4 91% 311
Chimp CONTIG*********** 98% 312
Mouse Or9g4 87% 312
Mouse Or9g4b 83% 312
Rat Or9g4 87% 312
Rat Or9g4b 82% 312
Cow OR9G4 86% 311
Cow OR9G4EP 84% 311
Cow OR9G4D 82% 311
Cow OR9G4CP 81% 311

Expression evidences

Source Accession
GNF Atlas2 gnf1h10902_at

Sequence information

Nucleotide sequence ATGGAAGTGGGAAATTGCACCATCCTGACTGAATTCATCTTGTTGGGTTTCTCAGCAGAT
TCCCAGTGGCAGCCGATTCTATTTGGAGTGTTTCTGATGCTCTATTTGATAACCTTGTCA
GGAAACATGACCTTGGTTATCTTAATCCGAACTGATTCCCACTTGCATACACCTATGTAC
TTTTTCATTGGCAATCTGTCTTTTTTGGATTTCTGGTATACCTCTGTGTATACCCCCAAA
ATCCTGGCCAGTTGTGTCTCAGAAGATAAGCGCATTTCCTTGGCTGGATGTGGGGCTCAG
CTGTTTTTTTCCTGTGTTGTAGCCTACACTGAATGCTATCTCCTGGCAGCCATGGCATAT
GACCGCCATGCAGCAATTTGTAACCCATTGCTTTATTCAGGTACCATGTCCACCGCCCTC
TGTACTGGGCTTGTTGCTGGCTCCTACATAGGAGGATTTTTGAATGCCATAGCCCATACT
GCCAATACATTCCGCCTGCATTTTTGTGGTAAAAATATCATTGACCACTTTTTCTGTGAT
GCACCACCATTGGTAAAAATGTCCTGTACAAACACCAGGGTCTACGAAAAAGTCCTGCTT
GGTGTGGTGGGCTTCACAGTACTCTCCAGCATTCTTGCTATCCTGATTTCCTATGTCAAC
ATCCTCCTGGCTATCCTGAGAATCCACTCAGCTTCAGGAAGACACAAGGCATTCTCCACC
TGTGCTTCCCACCTCATCTCAGTCATGCTCTTCTATGGATCATTGTTGTTTATGTATTCA
AGGCCTAGTTCCACCTACTCCCTAGAGAGGGACAAAGTAGCTGCTCTGTTCTACACCGTG
ATCAACCCACTGCTCAACCCTCTCATCTATAGCCTGAGAAACAAAGATATCAAAGAGGCC
TTCAGGAAAGCAACACAGACTATACAACCACAAACA
Conceptual translation MEVGNCTILTEFILLGFSADSQWQPILFGVFLMLYLITLSGNMTLVILIRTDSHLHTPMY
FFIGNLSFLDFWYTSVYTPKILASCVSEDKRISLAGCGAQLFFSCVVAYTECYLLAAMAY
DRHAAICNPLLYSGTMSTALCTGLVAGSYIGGFLNAIAHTANTFRLHFCGKNIIDHFFCD
APPLVKMSCTNTRVYEKVLLGVVGFTVLSSILAILISYVNILLAILRIHSASGRHKAFST
CASHLISVMLFYGSLLFMYSRPSSTYSLERDKVAALFYTVINPLLNPLIYSLRNKDIKEA
FRKATQTIQPQT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,510,710 56,510,710 Del(1) -/A rs34718198 (DbSNP)
11 56,510,623 56,510,623 NS A/G V/A rs513873 (DbSNP)
11 56,511,160 56,511,160 NS A/G F/S rs11228763 (DbSNP)
11 56,510,672 56,510,672 NS C/T D/N rs577576 (DbSNP)
11 56,511,025 56,511,025 NS T/C Y/C rs61736061 (DbSNP)
11 56,510,694 56,510,694 SYN C/T P/P rs1397053 (DbSNP)
11 56,743,147 56,743,147 NS A/G V/A 1000GP (CEU, CHBJPT)
11 56,743,196 56,743,196 NS T/C N/D 1000GP (CEU, CHBJPT)
11 56,743,218 56,743,218 SYN T/C P/P 1000GP (CEU, CHBJPT)
11 56,743,684 56,743,684 NS A/G F/S 1000GP (CEU, CHBJPT)
11 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C P/P 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V222A N206D F43S % Freq CORP
1 V D F 66.90 0.052
2 A D F 21.89 0.052
3 V D S 9.75 0.052
4 V N F 1.46 0.052

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9G4.aApr07-unspliced main_exon 3UTR chr11 56,742,828 56,742,831 -
CDS chr11 56,742,831 56,743,766 -
5UTR chr11 56,743,766 56,743,811 -