Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9G9 Olfactory Receptor

Gene Symbol OR9G91 (View this gene in GeneCards)
Family 9
Subfamily G
Pseudogene No
CORP pseudogene probability score
Aliases
External Ids HGNC: 31940   
Build #39 labels
Chromosomal location :- ()
Cluster
Synteny CLIC#0
Remarks no location in hg. 19

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9G1B 84% 300
Dog OR9G1 83% 300
Mouse Or9g20 77% 300
Rat Or9g20 77% 300
Cow OR9G1 81% 300

Sequence information

Nucleotide sequence ATGCAGAGGAGCAATCACACAGTGACTGAGTTTATACTGCTGGGCTTCACCACAGACCCA
GGGATGCAGCTGGGCCTCTTCGTGGTGTTCCTGGGCGTGTACTCTCTCACTGTGGTAGGA
AATAGCACCCTCATCGTGTTGATCTGTAATGACTCCCACCTCCACACACCCATGTATTTT
GTCGTTGGAAATCTGTCGTTTCTGGATCTCTGGTATTCTTCTGTCTACACCCCAAAGATC
CTAGTGATCTGCATCTCTGAAGACAAAAGCATCTCCTTTGCTGGCTGCCTGTGTCAGTTC
TTCTTCTCTGCAGGGCTGGCCTATAGTGAGTGCTGCTTACTGGCTGCCATGGCTTATGAC
CGCTACGTGGCCATCTCCAAGCCCCTGCTTTATGCCCAGGCCATGTCCATAAAGCTGTGT
GCATTGCTGGTAGCAGTCTCATATTGTGGTGGCTTTATTAACTCTTCAATCATCACCAAG
AAAACGTTTTCCTTTAACTTCTGCTGTGAAAACATCATTGATGACTTTTTCTGTGATTTA
CTTCCCTTGGTGAAGCTGGCCTGTGGCGAGAAGGGCTGCTATAAGTTTCTGATGTACTTC
CTGCTGGCCTCCAATGTCATCTGCCCCGCGGTGCTCATCCTGGCCTCCTACCTCTTTATC
ATCACCAGTGTCTTGAGGATCTCCTCCTCCCAGGGCCGCCTCAAAGCCTTCTCCACATGC
TCCTCCCACCTGACCTCTGTCACTTTATACTATGGCTCCATTCTCTACATCTATGCTCTC
CCTAGATCTAGCTATTCTTTTGATATGGACAAAATAGTTTCTACATTTTATACTGAGGTA
CTCCCCATGTTGAATCCCATGATCTACAGCCTAAGGAATAAGGATGTGAAAGAGGCTCTG
AAAAAACTTCTCCCA
Conceptual translation MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF
VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD
RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL
LPLVKLACGEKGCYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC
SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEAL

Protein domains and features

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.