Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9I1 Olfactory Receptor

Gene Symbol OR9I11 (View this gene in GeneCards)
Family 9
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR11-228, HsOR11.12.5, ORL3367
External Ids HGNC: 14718   GeneBank: AB065733, AF399531, BK004292, NM_001005211   ORDB: ORL3367   
Build #39 labels OR9I1
Chromosomal location 11:58,118,503-58,119,444 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9I3P 70.55% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9I1 84% 314
Chimp CONTIG229.235-14257 99% 314
Mouse Or9i1b 82% 314
Mouse Or9i1 83% 311
Rat Or9i1b 82% 314
Rat Or9i1-ps 80% 310
Cow OR9I17 81% 314

Expression evidences

Source Accession
GNF Atlas2 gnf1h10939_at

Sequence information

Nucleotide sequence ATGGCCAAGAATAATCTCACCAGAGTAACCGAATTCATTCTCATGGGCTTTATGGACCAC
CCCAAATTGGAGATTCCCCTCTTTCTGGTGTTTCTGAGTTTCTACCTAGTCACCCTTCTT
GGGAATGTGGGGATGATTATGTTAATCCAAGTAGATGTCAAACTCTACACCCCAATGTAC
TTCTTCCTGAGCCACCTCTCCCTGCTGGATGCCTGTTACACCTCAGTCATCACCCCTCAG
ATCCTAGCCACATTGGCCACAGGCAAAACGGTCATCTCCTACGGCCACTGTGCTGCCCAG
TTCTTTTTATTCACCATCTGTGCAGGCACAGAGTGCTTTCTGCTGGCAGTGATGGCCTAT
GATCGCTATGCTGCCATTCGCAACCCACTGCTCTATACCGTGGCCATGAATCCCAGGCTC
TGCTGGAGCCTGGTGGTAGGAGCCTATGTCTGTGGGGTGTCAGGAGCCATCCTGCGTACC
ACTTGCACCTTCACCCTCTCCTTCTGTAAGGACAATCAAATAAACTTCTTCTTCTGTGAC
CTCCCACCCCTGCTGAAGCTTGCCTGCAGTGACACAGCAAACATCGAGATTGTCATCATC
TTCTTTGGCAATTTTGTGATTTTGGCCAATGCCTCCGTCATCCTGATTTCCTATCTGCTC
ATCATCAAGACCATTTTGAAAGTGAAGTCTTCAGGTGGCAGGGCCAAGACTTTCTCCACA
TGTGCCTCTCACATCACTGCTGTGGCCCTTTTCTTTGGAGCCCTTATCTTCATGTATCTG
CAAAGTGGCTCAGGCAAATCTCTGGAGGAAGACAAAGTCGTGTCTGTCTTCTATACAGTG
GTCATCCCCATGCTGAACCCTCTGATCTACAGCTTAAGAAACAAAGATGTAAAAGACGCC
TTCAGAAAGGTCGCTAGGAGACTCCAGGTGTCCCTGAGCATG
Conceptual translation MAKNNLTRVTEFILMGFMDHPKLEIPLFLVFLSFYLVTLLGNVGMIMLIQVDVKLYTPMY
FFLSHLSLLDACYTSVITPQILATLATGKTVISYGHCAAQFFLFTICAGTECFLLAVMAY
DRYAAIRNPLLYTVAMNPRLCWSLVVGAYVCGVSGAILRTTCTFTLSFCKDNQINFFFCD
LPPLLKLACSDTANIEIVIIFFGNFVILANASVILISYLLIIKTILKVKSSGGRAKTFST
CASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKDA
FRKVARRLQVSLSM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/T Q/K 1000GP (YRI)
11 57,886,331 57,886,331 NS C/T E/K rs59849756 (DbSNP)
11 58,118,808 58,118,808 NS C/T V/I 1000GP (CEU)
11 58,118,963 58,118,963 NS G/T T/N 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A305T Q261K V213I E196K T161N % Freq CORP
1 A Q V E T 97.39 0.143
2 A Q V E N 1.61 0.143
3 A Q I E T 0.54 0.143
4 A K V E T 0.31 0.143
5 A Q V K T 0.08 0.143
6 T Q V E T 0.08 0.143

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9I1.aApr07-unspliced main_exon 3UTR chr11 58,118,500 58,118,503 -
CDS chr11 58,118,503 58,119,444 -