Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9I3P Olfactory Receptor

Gene Symbol OR9I3P1 (View this gene in GeneCards)
Family 9
Subfamily I
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-225, OR11-227, HsOR11.12.4P, ORL3548
External Ids HGNC: 15325   GeneBank: AB065732, AF399370, BK004734, BK004808   ORDB: ORL3548   
Build #39 labels OR9I3P
Chromosomal location 11:58,108,720-58,109,661 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9I1 70.55% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9I1 72% 314
Mouse Or9i1 71% 309
Rat Or9i13 69% 309
Cow OR9I17 68% 309
Orang OR9I1P 69% 309
Horse OR9I1D 71% 308
Chimp OR9I1 70% 314

Expression evidences

Source Accession
mRNA AB529254

Sequence information

Nucleotide sequence ATGGCCAAAAGAAATCTCAGCACTGTGACAGAGTTCATTCTTGTAGTCTTCACAGATCAC
CCTGAACTGGCAGTTCCACTCTTCCTAGTGTTTCTCAGTTTCTATCTTGTCACTTTTCTG
GGGAATGGGGGGATGATCATTCTAATCCAAGTGGATGCCCAACTCCACACCCCCGTGTAC
TTCTTCCTGAGCCACCTTGCTTTCCTGGATGCCTGCTGTGCCTCAGTAATCACCCCTCAG
ATTCTGGCCACACTGGCCACAGACAAGACAGTTATCTCCTATGGCTGCCGTGCTGTGCAG
TTCTCTTTCTTCACCATATGTGCAGGCACAGAGTGTTACCTGCTGTCAGTGATGGCCTAT
GACCGCTTTGTTGCCATTAGCAATCCACTGCACTGTAACATGACCATGACTCCAGGTACC
TGCAGGGTCTTTTTGGCCAGTGCCTTCATCTGTGGGGTGTCAGGGGCCATTCTGCATACC
ACGTGCACCTTCACCCTCTCCTTCTGTTGTGACAATCAGATCAACTTCTTCTTCTGTGAC
CTCCCACCCCTGCTGAAGCTCGCCTGCAGCAGCATGACACAAACTGAGATTGTCATTCTC
CTTTGTGCAAAATGCATGTTCCTAGCCAATGTCATGGTTATCCTGATCTGCTACATGCTC
ATTATCAGAGCCATTTTGAGGGTGAAGTCGGCAGGTGGGTAAGCCAAGACCTTCTCCACC
TGCACCTCCCATCTCACCACTGTTGTCCTCTTCTTTGGGACACTTGCCTTCATGTACCAG
AGAAGTAACTCCGCCAAATCCTCAGAGGAAGACAAGATAGTGTCTGTCTTTTACACTGTA
ATCATCCCTATGTTGAACCCCTTGATCTACAGTCTGAGGAACAAAGATGTAAAAGCTGCA
TTTGGAAAACTCGTTGGTAAATTCCAATTTCCAACGAATGTA
Conceptual translation MAKRNLSTVTEFILVVFTDHPELAVPLFLVFLSFYLVTFLGNGGMIILIQVDAQLHTPVY
FFLSHLAFLDACCASVITPQILATLATDKTVISYGCRAVQFSFFTICAGTECYLLSVMAY
DRFVAISNPLHCNMTMTPGTCRVFLASAFICGVSGAILHTTCTFTLSFCCDNQINFFFCD
LPPLLKLACSSMTQTEIVILLCAKCMFLANVMVILICYMLIIRAILRVKSAGGXKTFST
CTSHLTTVVLFFGTLAFMYQRSNSAKSSEEDKIVSVFYTVIIPMLNPLIYSLRNKDVKAA
FGKLVGKFQFPTNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 57,876,221 57,876,221 SNP T/C rs1447170 (DbSNP)
11 57,876,436 57,876,436 SNP A/C rs7935428 (DbSNP)
11 57,876,442 57,876,442 SNP C/G rs7112431 (DbSNP)
11 57,876,444 57,876,444 SNP T/C rs61732261 (DbSNP)
11 57,876,682 57,876,682 SNP T/C rs61738000 (DbSNP)
11 57,876,765 57,876,765 Del(1) -/A rs34718541 (DbSNP)
11 57,876,769 57,876,770 Del(2) -/CG rs10607597 (DbSNP)
11 57,876,962 57,876,962 SNP T/G rs61729635 (DbSNP)
11 58,108,749 58,108,749 SNP C/T 1000GP (CEU, CHBJPT)
11 58,108,786 58,108,786 SNP C/G 1000GP (CHBJPT)
11 58,108,795 58,108,795 SNP G/A 1000GP (CHBJPT)
11 58,108,815 58,108,815 SNP G/A 1000GP (CEU)
11 58,108,905 58,108,905 SNP C/T 1000GP (CHBJPT)
11 58,108,964 58,108,964 SNP C/A 1000GP (CEU, CHBJPT)
11 58,109,210 58,109,210 SNP C/T 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.