Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9M1P Olfactory Receptor

Gene Symbol OR9M1P1 (View this gene in GeneCards)
Family 9
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.11.32P, ORL3551
External Ids HGNC: 15327   GeneBank: AB065784, NG_004177   ORDB: ORL3551   
Build #39 labels OR9M1P, OR5BG1P
Chromosomal location 11:55,855,592-55,856,521 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AP2 55.23% 306
OR5AR1 52.27% 308
OR5I1 57.05% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9M1 88% 309
Chimp CONTIG970.38-26808 57% 305
Chimp CONTIG970.44-6293 55% 309
Chimp CONTIG229.55-47070 53% 308
Mouse Or9m1 84% 307
Mouse Or9m1b 82% 308
Mouse Or9m2 80% 308
Rat Or9m1b 83% 309
Cow OR9M1 86% 309
Cow OR9M1D 84% 309

Sequence information

Nucleotide sequence ATGGAGCTGGAGAATGGCACTGTGAAGACTGGGTTCTTTCTCCTGGGATTCAGCGACCAT
CTGGAACTTCAGAGTCTCCTTTTTGCAGAATTTTTTTCCATCTACTCTGTTACTCTGATG
GGGAACCTTGGAATGATTTTATTAATCACAATCAGTTCCCACTTGCACACTCCTATGTAC
TTTTTCCTCTGTGTGTTGTCCTTCATAGATGCATGCTACTCTTCTGTCATTGCTCCCAAA
TTACTTGTGAACTTGGTTTCTGAAAAGAAGACCATTTCTTACAATGGCTGTGTTGCACAG
TTATATTTCTTCTGCTCTTTAGTTGACACAGAATCTTTCCTCTTGGCTGCCATGGCTTAA
GACCGGTACATAGCAATCTGTAACCCGCTGCTCTATACAGTGATTATGTCCAAGAAGGTT
TGTTGCCAGCTTGCAATTGGAGCATTTTTGGGGGGCACTATGAGCTCAATTATTCATACC
ACGAACACTTTCCATCTGTCATTCTGCTCCAGAGATATTAACCATTTCTTTTGTGATATC
TCCCCACTCTTCTCTCTGTCCTGCACTGACACATACATGCATGACATCATTCTGGTGGTC
TTTGCCAGTTTTGTGGAAGCAATCTGTCTTCTATCAGTTCTCCTTTCTTATGTCTTCATT
ATGGCAGCTATTCTTAGAACAGGTTCTGTGGAGGGAAGAAGAAGAGGGTTCTCCACTTGT
GCTTCCCACCTGACTGTGGTCACTATGTATCATGGTACCTTGATCTTCATTTATTTGCGT
CCCAGCACTGGCCATTCACTGGATATTGACAAAGTGACCTCTGTGTTCTATACTTTGATT
ATACCTATGTTGAACCCTCTAATTTACAGTCTAAGGAACAAAGATGTCAAAAATGCTTTT
AGAAAAGTGATTGGCCGAAAATTACTTCCT
Conceptual translation MELENGTVKTGFFLLGFSDHLELQSLLFAEFFSIYSVTLMGNLGMILLITISSHLHTPMY
FFLCVLSFIDACYSSVIAPKLLVNLVSEKKTISYNGCVAQLYFFCSLVDTESFLLAAMAXbr/>DRYIAICNPLLYTVIMSKKVCCQLAIGAFLGGTMSSIIHTTNTFHLSFCSRDINHFFCDI
SPLFSLSCTDTYMHDIILVVFASFVEAICLLSVLLSYVFIMAAILRTGSVEGRRRGFSTC
ASHLTVVTMYHGTLIFIYLRPSTGHSLDIDKVTSVFYTLIIPMLNPLIYSLRNKDVKNAF
RKVIGRKLLP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,623,704 55,623,704 SNP A/G rs12284502 (DbSNP)
11 55,623,847 55,623,847 SNP C/T rs7116820 (DbSNP)
11 55,623,845 55,623,845 SNP C/T rs35495896 (DbSNP)
11 55,856,371 55,856,371 SNP T/C 1000GP (CEU, CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,622,968 55,625,997 Deletion #217 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.