Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9Q2 Olfactory Receptor

Gene Symbol OR9Q21 (View this gene in GeneCards)
Family 9
Subfamily Q
Pseudogene No
CORP pseudogene probability score 0.31 (functional)
Aliases OR11-230, HsOR11.12.8
External Ids HGNC: 15328   GeneBank: AB065859, BK004685, NM_001005283   
Build #39 labels OR9Q2P
Chromosomal location 11:58,190,491-58,191,432 (+)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9Q1 73.46% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9Q3 78% 313
Mouse Or9q2 86% 314
Rat Or9q2 84% 312
Cow OR9Q6 78% 313
Orang OR9Q1 75% 309
Horse OR9Q7P 76% 314
Chimp OR9Q1 73% 309

Expression evidences

Source Accession
mRNA BC140718

Sequence information

Nucleotide sequence ATGGCTGAAAGGAATTACACCGTAGTGACGGAGTTCTTCCTTACTGCATTTACTGAACAT
CTCCAGTGGAGGGTTCCTCTCTTCCTCATATTTTTGAGTTTCTATCTTGCCACTATGTTA
GGGAACACAGGCATGATCCTCCTGATCCGTGGCGATCGTCGGCTCCACACCCCGATGTAC
TTCTTCCTCAGCCACCTTTCCTTGGTGGACATCTGCTACTCGTCCGCCATCATCCCTCAG
ATGCTGGCTGTGCTGTGGGAGCACGGCACAACCATCTCCCAGGCTCGCTGTGCAGCTCAG
TTCTTCCTCTTCACCTTCTTTGCCTCCATCGACTGCTACCTTCTGGCCATCATGGCCTAT
GACCGCTACACGGCCGTGTGCCAGCCCCTGCTTTATGTCACCATCATAACCGAGAAGGCC
CGCTGGGGCCTAGTCACTGGGGCTTACGTTGCTGGTTTTTTCAGTGCCTTTGTTCGAACG
GTCACAGCCTTCACTCTCTCCTTTTGTGGAAACAATGAGATCAACTTCATTTTCTGTGAC
CTCCCTCCTCTATTAAAACTCTCCTGTGGGGACAGCTACACTCAGGAAGTGGTGATTATT
GTGTTTGCTCTTTTCGTCATGCCTGCCTGTATCTTGGTGATCTTGGTATCCTACCTGTTT
ATCATTGTGGCCATCCTGCAGATCCACTCTGCTGGAGGCCGGGCCAAGACCTTCTCCACC
TGCGCCTCCCACCTCACTGCCGTCGCTCTTTTCTTTGGCACCCTCATCTTCATGTACCTG
CGAGACAACACAGGCCAGTCCTCCGAGGGAGACCGAGTGGTGTCTGTGCTCTACACGGTG
GTGACCCCAATGCTGAATCCCCTTATCTATAGCCTGAGAAACAAGGAGGTAAAAGAGGCC
ACTAGGAAAGCCCTGAGCAAATCAAAGCCTGCTAGAAGACCC
Conceptual translation MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY
FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY
DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD
LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST
CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA
TRKALSKSKPARRP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C C/R 1000GP (YRI)
11 100 -100 SYN G/A T/T 1000GP (YRI, YRI, YRI)
11 57,958,136 57,958,136 SYN A/G P/P rs61902822 (DbSNP)
11 57,958,497 57,958,497 NS C/T R/C rs34337292 (DbSNP)
11 57,958,775 57,958,775 SYN C/T D/D rs7120468 (DbSNP)
11 57,958,796 57,958,796 SYN C/T Y/Y rs73470064 (DbSNP)
11 58,191,025 58,191,025 NS T/C C/R 1000GP (CEU, CHBJPT)
11 58,191,303 58,191,303 SYN C/T D/D 1000GP (CEU, CHBJPT)
11 58,191,376 58,191,376 NS G/C E/Q 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 234 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C179R % Freq CORP
1 C 79.88 0.347
2 R 20.12 0.693

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9Q2.aApr07-unspliced main_exon CDS chr11 58,190,491 58,191,432 +
3UTR chr11 58,191,432 58,191,435 +