Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Chimpanzee symbols

Chimpanzee CONTIG10409.3-1803 Olfactory Receptor

Sequence information


Nucleotide sequence

AGTATTTCTCTTTTAAATTATTTATTTAGCACATTCTTAGAAGTCAAATGCCTAGATGGA
GAATACATGGGTAAAAACAAAGAACAAATTCCCTGAGGTCCTGGAAATACAGGAAGCCAA
ATTAGTCACTAATTATAAATCATATCTTGCTTATTTAGGATTCTCAACTCTCAGCTGGAA
CTCATATCAACACCTGAGAAATGGAAAATCAAAACAATGTGACTGAATTCATTCTTCTGG
GTCTCACAGAGCACCTGGAGCTGCGGAAAATATTTTCTGCCGTGTTTCTTGTCATGTATG
TAGCCACAGTGCTGGAAAATCTACTTATTGTGGTAACTATTATCACAAATCAGAGTCTGA
GGTCACCTATGTATTTTTTTCTTACCTTCTTGTCCCTTTTGGATGTCATGTTCTCATCTG
TCGTTGCCCCCAAGGTGATTGTAGACGCCCTCTCCAAGAGCACTACCATCTCTCTCAAAG
GCTGCCTGACCCAGCTCTTTGCGGAGCATTTCTTTGGCGGTGTGGGGATCATCCTCCTCA
CTGTGATGGCCTATGACCGCTACGTGGCCATCTGTAAGCCCCTGCACTACACGATCATCA
TGAGTCCACGGGTGTGCTGCCTAATGGTAGGAGGGGCTTGGGTGGGGGGATTTATGCACG
CAATGATACAACTTCTCTTCATGTATCAAATACCCTTTTGTGGTCCTAATATCATAGATC
ACTTTATATGTGATTTGTTTCAGTTGTTGACACTTGCCTGCACGGACACCCACATCCTGG
GCCTCTTAGTTACCCTCAACAGTGGGATGATGTGTGTGGCCATCTTTCTTATCTTAATTG
CGTCCTACATGGTCATCCTATGCTCCCTGAAGTCTTACAGCTCTAAAGGGCGGCACAAAG
CCCTCTCTACCTGCAGCTCCCACCTCACGGTGGTTGTATTGTTCTTTGTCCCCTGTATTT
TCTTGTACATGAGGCCTGTGGTCACTCACCCCATAGACAAGGCAATGGCTGTGTCAGACT
CAATCATCACACCCATGTTAAATCCCTTGATCTATACACTGAGGAATGCAGAGGTGAAAA
GTGCCATGAAGAAACTCTGGATGAAATGGGAGGCTTTGGTTGGAAAATAACTGCAATGCT
GAGAACATCAATCATGTATTTCCCAAAAGGAGAAGTCATTCTTTCAGAAATGTGTAAGAG
CTAAAACTGTCCATTCCTCGGTGGCTGTCAAAGGAAGCTTTTTTTGAGACAGAGTCTCGC
TGTGTCACCCAGGCTGGAGTGCAGTGGCACTATCTTGGCTCTGCAGTCTCCACCTCCTGG
GTGATTA


Conceptual translation

MENQNNVTEFILLGLTEHLELRKIFSAVFLVMYVATVLENLLIVVTIITNQSLRSPMYFF
LTFLSLLDVMFSSVVAPKVIVDALSKSTTISLKGCLTQLFAEHFFGGVGIILLTVMAYDR
YVAICKPLHYTIIMSPRVCCLMVGGAWVGGFMHAMIQLLFMYQIPFCGPNIIDHFICDLF
QLLTLACTDTHILGLLVTLNSGMMCVAIFLILIASYMVILCSLKSYSSKGRHKALSTCSS
HLTVVVLFFVPCIFLYMRPVVTHPIDKAMAVSDSIITPMLNPLIYTLRNAEVKSAMKKLW
MKWEALVGK