Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Chimpanzee symbols

Chimpanzee CONTIG15690.1-1022 Olfactory Receptor

Sequence information


Nucleotide sequence

GAAATAGTGCGCTTAATTAATACNTTTTGCCAGCATTTGATAAATGCTGCAAAGGTTATG
ACAAGAGATAGACTGCGTTCTCTTCACTGTTTGTTACATGCTCAAGGCCAAGCATCCTAA
CTTATAAAAACGCCTTAAATCGATTCCAGGCCCGTCCCCCTCCGCATCAACCGTGACCCT
TTGCCNTCAGCGAATGGCAATCACCATGATGGCCACATTGAATTTAAGTAGCTTCAATCC
AGGACTCTTCATTCTGTTGGGGATCCCAGGGCTGGAGTGGTTCTGCATATGGATGGGAAT
TCTCTCCTTTACCAGTTACCTCGTCTCCCTTGCAGGGAATGTCATCCTTCTCTACCTTAT
CACTGTGGAACACAACCTCCATAAACCCATGTTTTTCTTCCTCTCTATACCGGCCTCTGC
AAATCTCATATTATGCATTACATATTTCCCCAAAACATTTGGGATATTCTAGCTGAAAGC
TCAGAAAATAATATTTCCTGGATGCTTCACCAGGTTTTTTTTTTTTTTGGCCTACCTCAC
TTCAGCTTTTTTTCTGGACTTGGCCATCTTGTTGGGTCTGGCATTTGGTCATTACATGAC
CATTGGTTTCCTTCTGAGATACACCAGTGGCTTGACACCTCGACACTTGGCAAGATTGTG
GTGAGCATTGATTGAAGGTTTAATAACATTTTGCCCATTGATTTCCTGGGGAAGCATTTG
CCCTTCTGCAGAACACACATTAATTCTAACACATACTGTGAGCACATAGTTGTGGCCCTG
CTTTCCTATGCTGATATGTCCATCAATATCTGGTATGACTTTACTATATTAGTAATGACT
ATTATCTCAGATCTGATCCTCACTGATATTTCCTACACCCTCACCCTTCATGCTGTTTTC
CACCTTCCATCCTTCTGAAGGCCCTAAGCACCTGTGGTTCTCATGTCAGTGTCATTCTCA
TGTTTTACACACCAACAATGCTTTCTGCCCTTACTCATCACTTTGGCCAGAGTATCTCTT
GCACTTTTTACATCATGTTTGTGGGCCTCTATAGGGCAATCCCTCCTGTACTCAATTCCA
TAATTATGGAGTAAAAACAAAGCAGATTGGAAACAAGGTCATACTTTTATTCTTTCTTAA
AGGGATGCAGTGATATGAGGATGAGAATATGGATAAATGGGCTGTGAAAAATTTAAAAGA
ATTCTTATGTAAATCACTAGCAGAAAGTCTTCCAATGAGAGATCCAATTTTTATGAATTT
TAAGATTTCAGTGCTATTGGAGAAACTCAGTACAATTAAAGGAATTAGGAGATAAGAGAG
ATAAAGATTATTCGAGTTGCAAGAAAATAATAGGCATCAAATGGAGGCATTCTAATTTTC


Conceptual translation

MATLNLSSFNPGLFILLGIPGLEWFCIWMGILSFTSYLVSLAGNVILLYLITVEHNLHKP
MFFFLSIPASANLILCITYFPKTFGIF*LKAQKIIFPGCFTRF/FFFGLPHFSFFS/T
/AILLGLAFGHYMTIGFLLRYTSGLTPRHLA/IVVSID*RFNNILPIDFLGKHLPFCR
THINSNTYCEHIVVALLSYADMSINIWYDFTILVMTIISDLILTDISYTLTLHAVFHLPS
/LKALSTCGSHVSVILMFYTPTMLSALTHHFGQSISCTFYIMFVGLYRAIPPVLNSIIM
E*KQSRLETRSYF/FFLKGMQ*YEDENMDKW