Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Chimpanzee symbols

Chimpanzee CONTIG970.44-6293 Olfactory Receptor

Sequence information


Nucleotide sequence

AAACTAAGTTTATGCATTTGTGTTATACAAAGTTGAACTTTTTAAAATTTCACAAAAAGT
TTTATTCTTTGCTGATAAGATAAACTATCCTACTTTTTCTGATGTCTTTTTACAGGATAC
AGCCAAAACTAAAATTTAGACTATATAATGGAGAATAATTTTTAAGTTTCTTTTCCTCCA
ACCTCATATAAATTGGAGACATGGGCAAGGAAAACTGCACCACTGTGGCTGAGTTCATTC
TCCTCGGATTATCAGATGTCCCTGAGTTGAGAGTCTGCCTCTTCCTGCTGTTCCTTCTCA
TCTATGGAGTCACGTTGTTAGCCAACCTGGGCATGATTGCACTGATTCAGGTCAGCTCTC
AGCTCCACACCCCCATGTACTTTTTCCTCAGCCACTTGTCCTTTGTAGATTTCTGCTACT
CCTCAATAATTGTGCCAAAAATGTTGGCTAATATCTTTAACAAGGACAAAGCCATCTCCT
TCCTAGGGTGCATGGTGCAATTCTACTTGTTTTGCACTTGTGTGGTCACTGAGGTCTTCC
TGCTGGCCGTGATGGCCTATGACCGCTTTGTGGCCATCTGTAACCCTTTGCTATACACAG
TCACCATGTCTTGGAAAGTGTGTGTGGAGCTGGCTTCTTGCTGCTACTTCTGTGGGACGG
TGTGTTCTCTGATTCACTTGTGCTTAGCTCTTAGGATCCCCTTCTATAGATCTAATGTGA
TTAACCACTTTTTCTGTGATCTACCTCCTGTCTTAAGTCTTGCTTGCTCTGATATCACTG
TGAATGAGACACTGCTGTTCCTGGTGGCCACTTTGAATGAGAGTGTTACCATCATGATCA
TCCTCACCTCCTACCTGCTAATTCTCACCACCATCCTGAAGATGGGCTCTGCAGAGGGCA
GGCACAAAGCCTTCTCCACCTGTGCTTCCCACCTCACAGCTATCACTGTCTTCCATGGAA
CAGTCCTTTCCATTTATTGCAGGCCCAGTTCAGGCAATAGTGGAGATGCTGACAAAGTGG
CCACCGTGTTCTACACAGTCGTGATTCCTATGCTGAACCCTGTGATCTACAGCCTGAGAA
ATAAAGATGTGAAAGAAGCTCTCAGAAAAGTGATGGGCTCCAAAATTCACTCCTAGGGAA
GATTTTATTAGCACAATTCAGGATTCCCAAGTAATGGCAGGCGGGGGTTCACGGGAGAGG
CACAGTGTTGGAGTAGAGAGAAGAAGGAGCTCAGTAGTTATAAGCGAGTCTTTTTTGATT
CACTTATCTTTGTGCTTCTTAAACATGTTTCAAAATTTGCTGCCAACTTTTAAAAAATAA
ATACATAATGTTT


Conceptual translation

MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSQLHTPMY
FFLSHLSFVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTVTMSWKVCVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNPVIYSLRNKDVKEA
LRKVMGSKIHS