Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR10G4P Olfactory Receptor

Gene Symbol OR10G4P
Organism Cow
Family 10
Subfamily G
Pseudo Yes
Location chr29:26,888,000-26,888,900 (-)

Sequence information


Nucleotide sequence

ATGACAAATATGAGCCTAGTGACAACGTTCATCCTCACGGGCCTTCCCCATGCACCAGAG
CTGGACACATTTCTCTTTGGAATCTTCCTGGTGATCTATGTCCTCACTGTGGTGGGGAAC
CTTCTCATCCTTCTGGTGATCACAGTGGATCCCCACCTGCACACCCCCATGTACTACTTC
CTAACCAACCTGTCCTTCATTGACATGTGGTTTTCCACAGTCACTGTGCCCAAAATGCTG
ATGACCCTGGTGTCCCCAGAAGGCAGTCCTGTCTCCTTTCCTGGCTGTGTGGCCCAGCTC
TACTGTTTCCACTTCCTGGGCAGCACCGAGTGCTTCCTGTACACCGTCATGTCCTATGAC
CGCTTCCTGGCCATCAGTTACCCGCTCAGGTATGCCAGCATGATGAGTGGGAGGACTTGC
GCCATCCTGGCCACAACCACGTGGCTCAGTGGCTCTGTGCACTCTGCTGTCCAGACCACA
CTGACGTTCCGTTAGCCCTTCTGTGGACCCAACCAGATCCAGCATTACTTCTGTGATGCA
CCCCCCATCCTCAAACTGGCCTGTGCAGACACGTCCACCGTGGAGATGGTGATCTTTGTC
AACACTGGGGTGGTGGCCTCAGGCTGCTTTCTCCTGATAGTGCTGTCCTACGTGTCCATC
GTCCATTCCATCCTGAAGATCCGCACCTCAGAGGGAAGATGGAGAGCCTTCCAGACCTGT
GCCTCCCACTGCACTGTGGTTCTTTGCTTCTTTGTTCCCTGTGTTTTCATTTACCTGAGA
CCAGGCTCCAAGGAGGCTATGGACAGCATTGTGGCTGTTTTCTACACTGTGATGACACCC
CTTCTGAACCCTGTAGTCTAGACCCTGAGGAACAAGGACGTGAAGAAAGCTCTGTTGAAG
CTTAAAGACAAAATAGTGTATTTGCAGAGC


Conceptual translation

MTNMSLVTTFILTGLPHAPELDTFLFGIFLVIYVLTVVGNLLILLVITVDPHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPEGSPVSFPGCVAQLYCFHFLGSTECFLYTVMSYD
RFLAISYPLRYASMMSGRTCAILATTTWLSGSVHSAVQTTLTFR*PFCGPNQIQHYFCDA
PPILKLACADTSTVEMVIFVNTGVVASGCFLLIVLSYVSIVHSILKIRTSEGRWRAFQTC
ASHCTVVLCFFVPCVFIYLRPGSKEAMDSIVAVFYTVMTPLLNPVV*TLRNKDVKKALLK
LKDKIVYLQS